KEGG   Bacillus subtilis subsp. subtilis 168: BSU21370Help
Entry
BSU21370          CDS       T00010                                 

Gene name
yomG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: fn3 RPW8 MukF_M
Motif
Other DBs
NCBI-GeneID: 939135
NCBI-ProteinID: NP_390020
Pasteur: BG13594
BSORF: BG13594
UniProt: O31978
Position
2256832..2259459
Genome map
AA seq 875 aa AA seqDB search
MLNKFKPGEILLSLAKPNKKKIANIADFSNVSLNLSFADLNDLSFNIPLKARYNFLMKPN
HVAKLMREWYLIKAEFLNRVEWFVITGLTKSENEEQTIQVRCQGLPYILHKNKIRSYQGV
SKNLQEVATDCLKGTRLNIGYIDPSFNEKRRSFDVTSTRYEFLKTIWETFEAVPVFDTVK
NTVSFYKKDTVSKYKGVQFSPERFMIDMEDTIDIDEVVTRLNITGKDGIVINSVNPTGQS
YLDDFSYFLYPFKRDKNRNVITHSDYMDDDLCHAILDYNELVNKEGSSFHLLLNQKRDLE
TQKTTQENKLFTLENIELQQILDKITVAKKAGDDTKDLIKQRDAKLLEVTAKKAEISRIN
SQITNISQEIEKLKDRLSMDKFLGEELKKQLSYFIFEDDWTNDNIFDETELYEKGLEELS
NRNAPPVDIRTNIVNLFNVNSEKAFWDRIYLGDIIRVVNKNFRTDVKATLSGMTFDFDQQ
SIQVTLSNGKRARSLEQEFANTLYTTKKASTEYNKKKIDYDTLLVNYNARNDRISSPVAN
PTILNNGTAITHVVNDNGSVDISIEWQFPNSKEDKYNIDGFLVHCYSDTSSDTYIFGSKM
SSEQYLSVSYDKRIATLTGQVSNKYYTFGIQAYRTVEASIDSSGRILSDIIQPQFPSENP
YLPSNSVEVKGSLSGRVNGLYTISTEAKPEDPEKGTIWINPKNNKQELFNGEEWVVSSAG
SADSLNGFTASTTTSPNSIPVRNESGIISGSIDGNAEMLGGRAASDYALAENIPIPPKFA
KGIYTGDGTLSKQIPLTFTPDLVKITPISPEDSQLVIESQLGGYAYQVTSTGLSLIGGDL
GYGALGNNLFVTGSDSNCRGNKLNVKYIWEAYQQN
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaataagtttaaaccaggcgaaatcctcctttctttagcaaaaccaaataaaaag
aaaatcgctaatattgcggatttctcaaatgtatctcttaatctaagctttgctgattta
aatgatctatcttttaatattccactcaaagccaggtataattttttgatgaagccaaac
catgtggcaaaactaatgcgtgagtggtatcttatcaaggcagaattcttaaacagagtt
gaatggtttgtgataaccggtttaacaaaatcagaaaatgaggagcaaacaatacaagtt
agatgtcaaggactaccgtacatccttcataaaaacaaaataaggtcatatcaaggagtt
tcaaagaatctacaggaagtggccactgattgtcttaaaggcacaagactcaatatcggt
tatattgatccttcatttaatgaaaaaagacgatcatttgatgtcacttcaacaagatat
gagtttttaaaaacgatatgggaaacttttgaggcagtcccagtcttcgacactgtaaag
aacactgtctctttttataagaaagacacagtatccaagtacaaaggtgtccaattctcc
cctgaacgatttatgattgatatggaagataccattgatattgatgaagtcgtaacacgt
ttaaacatcacaggtaaagacggaattgtgattaattcggtaaaccctactggacagagt
tacttggacgatttttcttattttctatatccttttaaacgtgataaaaacagaaatgta
ataacacacagtgattacatggatgatgatttatgtcatgcgattttggattataatgaa
cttgtcaataaagaaggctcttctttccacctccttttaaaccaaaaaagggatttagaa
acccaaaaaacgactcaagaaaataaactcttcactcttgaaaacattgagctacagcaa
attttagataagataaccgtagcgaaaaaagccggtgacgacacaaaagatcttattaaa
caaagagatgcaaaactattagaagttaccgccaaaaaagctgaaatatccagaataaac
tcgcaaatcacaaacatttctcaggaaatagaaaaactaaaagaccgtttatcgatggac
aagtttcttggtgaggagcttaagaaacaactgtcttattttatttttgaagatgattgg
actaatgataatatttttgatgagacagagctttacgaaaaagggttagaggaactgagc
aatagaaacgctccccctgttgatatcagaacgaacatcgtaaacctatttaatgttaat
agcgaaaaggcattttgggatagaatatatctcggagatataatcagggtagttaataag
aatttcagaaccgatgtcaaagcaaccctttcagggatgactttcgattttgatcaacag
agtatacaggttacactctcaaacgggaaaagagccaggtcattggaacaggaatttgct
aatactttgtatacaactaagaaagcatccacagagtataataagaaaaaaattgattat
gatacacttcttgttaattacaatgcacgtaatgatcgtatctcatctcctgtggcaaac
ccaactattcttaataacggaactgcaataacacatgttgtcaacgataatggatcggtt
gatatctccattgaatggcagttcccaaattctaaagaggataagtacaatattgacgga
ttccttgtccactgttactcagatacatcttcagacacctatatatttggatcaaagatg
tcatctgaacagtatctatcggttagctatgataagagaatcgcaacccttacaggccag
gtttcaaataagtattatacgtttggaattcaagcctaccggactgttgaagcgtctatt
gatagcagcggacgtatactttccgacattattcaaccccaatttccttcagagaacccc
tacctcccctctaattcggttgaagttaaaggaagtcttagtggaagagttaatggcctc
tatacaatctccacggaagctaagccagaagatccggaaaaagggacaatctggatcaat
ccaaagaacaataaacaagaactatttaacggagaagaatgggttgtctcatctgcaggt
tcagcagactccttgaatggttttacagcttcaacaacgacttctccaaactctatacca
gtgcgtaatgaatcagggatcattagtggttcaatagacggtaatgcagagatgctaggt
ggacgagcagcatctgattatgcattagctgaaaacatccccattcctcccaagtttgca
aaaggtatttatacaggagacggcactctcagtaagcaaatcccccttacctttactcct
gatttagtcaaaataactccgatttcacctgaagacagtcaactagtaattgaaagccaa
ttggggggctatgcctatcaagttacttcaactggactttcccttattggaggagattta
ggatacggtgctttgggaaacaatctatttgtcacaggctcagatagtaactgcagagga
aataaattaaacgttaaatatatctgggaagcctaccaacaaaattaa

DBGET integrated database retrieval system