KEGG   Bacillus subtilis subsp. subtilis 168: BSU21380Help
Entry
BSU21380          CDS       T00010                                 

Gene name
yomF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939134
NCBI-ProteinID: NP_390021
Pasteur: BG13593
BSORF: BG13593
UniProt: O31979
Position
2259475..2260296
Genome map
AA seq 273 aa AA seqDB search
MADFAKLYNDPILSKKRIGSVEDPYLTYNETLTIFNGRALLTEIPNREFRVEVTGDNKEW
REIEDGELDDNYFKVDYLMGVVFFNASNEGKSLTFNYSGEGASFFPASRIWIKRQGNMVI
ETLQGLIDEAEDTIIRMNERIAECERVTKRCQEVTAWCRQATSNYEEVVENTRKIYKPSV
YTYSDIFTYYPTPQIGWTVTVKETKIVYRWDGFEWVDIGTSEVYEGFNILLSATEPFNAN
YIWYKDASFSPEKKRVVVSDTAPDSGQVWYKTD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ctggctgattttgctaaattatataatgatccaatattaagtaaaaagagaataggttct
gttgaagacccctatctaacttacaatgaaacattgacaatatttaatggaagagcactc
ctaactgagattccgaacagagaatttcgtgttgaagttactggggacaacaaggaatgg
cgagagattgaagatggagaacttgacgacaactattttaaggttgattaccttatggga
gttgtcttttttaatgcttcaaatgaaggaaaatcgctaacctttaattatagtggtgaa
ggagcttccttcttccctgcctctcgaatttggataaaacgacaagggaatatggttatt
gaaactcttcaaggacttatcgatgaagctgaagatacaataattcgaatgaatgaacgt
atagctgaatgtgaacgagttacaaaacgatgccaagaagtgacagcctggtgtagacag
gctacatcaaattatgaagaagttgtagaaaacacaagaaaaatttataaaccatctgtc
tatacctattcagatattttcacctattacccaaccccacagattggttggacggtgact
gttaaagaaacaaaaatcgtttatcgatgggatggatttgagtgggtagatattggaact
tccgaagtatatgaaggttttaatatactcctaagcgcaacagaaccatttaatgcaaat
tatatctggtataaggatgcctctttttcacctgagaaaaaacgagttgttgtttcagat
acagcaccagattcaggacaagtatggtacaaaactgactaa

DBGET integrated database retrieval system