KEGG   Bacillus subtilis subsp. subtilis 168: BSU21390
Entry
BSU21390          CDS       T00010                                 

Gene name
yomE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NAGPA Pectate_lyase_3 Beta_helix
Other DBs
NCBI-GeneID: 939136
NCBI-ProteinID: NP_390022
Pasteur: BG13592
BSORF: BG13592
UniProt: O31980 A0A6M4JKD1
Position
2260333..2262267
AA seq 644 aa
MAGFYRYDQNLDKYVPMPVELLASEGEEYTAPKITQKFNEVETKTTEILNKVLTDDRYFT
VTSSFKQDATLGIEYYVTKVTPKTTEAKKSMVQKTFAYDFEKSIDPTSSYFGTTNRETVL
SMAKRKRSVVAINASGWRSNGEVMGLQIKDGVLYKDYDAAGYTGAEACVFFDDGTMKVYG
NREVDADILISKGARNSFAFGIWLVKDSKPRTAQMTTWADLNVKHPRQAIGQRSDGTLVI
ITVDGRSLRSSGITAYDMPSLFLSEGCINAFLLDGGGSSQTAVEGKYINNISDGIERAVV
DTLTISYPDDDTDSRFFEVQEGRGLATSLNRRVEFIESKPTWNVLDLGFSPDGLIDNTAK
FKKALSDLSEKGGGKLHFPKGTYLIGKQNTTSASEKIELPSNVSIVGERRSYTKLLRNPN
HSLDELLRITDHNYIEGIEIDGNSSVNKSSCRLIAGGNIKSFKMKDCSLVNATDRGVSIH
GIGKSITIEGMYISNIANECINVAEGEIIKLIDSEITFSGTALWVGNAANIFTKNNLAKS
LKTFVRYKNSQNAICSGNIITNNIDRAIWGSVREAVFSDNVFKQCHSDYHLYFIQEDTGT
NDLIVTGNSVYSDVEGTAFIRTPSDIDRRRVSGNVGNIPSLNLD
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggctggtttttatagatatgatcaaaatttagataaatatgttccgatgcctgttgaa
ctactagcttcagaaggagaagaatacaccgctcctaagattactcagaagtttaatgaa
gtagaaacgaaaacaacagaaattttaaacaaggtattaactgatgacagatattttaca
gtaacaagttcttttaaacaggatgccacacttggtattgagtactatgttacaaaggtt
actcctaaaacaaccgaagctaaaaaaagtatggtgcaaaaaacgtttgcatatgacttt
gaaaaatccattgatcccacatcttcttattttggtacaacaaatcgtgaaacagtttta
agtatggcaaaacgaaaaagatctgttgttgcaataaacgctagtggttggcgatcaaat
ggtgaagtcatggggcttcaaattaaagacggagttctctacaaagattatgacgctgct
ggatacacaggcgctgaggcttgtgtattttttgatgatggaactatgaaggtttacgga
aacagagaagttgatgccgacatcctaatttctaaaggcgcacgaaactcttttgctttt
ggcatttggctagttaaagattctaagccaagaacggctcaaatgactacatgggcagat
ttaaatgttaagcatcctcgacaagccattgggcaaagatctgatggtacactagttatc
attactgtagatggccgctcacttcgatccagtggtattacagcttatgatatgccatct
ttatttttatctgaaggctgtattaatgcatttcttttagatggtggtggaagctctcaa
actgctgttgaaggaaaatatattaataacattagtgatggcattgaacgtgcagtggtc
gataccttaacaatttcatatcctgatgacgatacagatagcagattttttgaagttcaa
gaaggaagaggtttggcaacaagtctaaacagacgtgtagagtttattgaatccaagcct
acttggaatgtattagatttaggcttctcaccagatggcttaatcgataatacagctaag
tttaaaaaagcccttagtgatttatctgaaaaaggtggagggaaactacattttccgaaa
ggtacatatttaatcggtaagcagaatacaactagcgctagtgaaaaaattgaactccct
tcaaatgtctcaattgttggtgaaagacgatcctacactaaactccttcgaaatccaaat
cactcacttgatgaattgttgcgaatcacagatcacaattatatagaaggcattgaaatt
gatggcaatagcagtgtaaataagagtagctgccgattgatcgcaggtggaaatataaaa
tcatttaaaatgaaagactgcagcttggttaatgctacagaccgaggagtgagtattcac
gggatcggcaagtctataacgattgaaggaatgtatatttccaatatagccaacgagtgc
atcaacgttgctgaaggagaaattattaaactaattgactctgagatcacatttagcggt
actgccctttgggtgggtaatgctgcaaatatcttcactaagaataacctcgcaaaatcc
ttaaaaaccttcgtccggtacaaaaactctcaaaatgcaatttgttcaggaaacattatc
actaataatattgatcgcgcaatttggggatctgtaagagaagctgttttctctgataat
gttttcaagcaatgccactctgattatcacctttactttattcaagaagacactggaaca
aacgatttaattgtaactggaaactcagtttatagtgatgttgaaggaacagctttcatt
agaactccatcagatatagacagaagacgagtgtcgggtaacgtaggtaatatacctagc
ttgaacttggattaa

DBGET integrated database retrieval system