KEGG   Bacillus subtilis subsp. subtilis 168: BSU21400Help
Entry
BSU21400          CDS       T00010                                 

Gene name
yomD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4_baseplate
Motif
Other DBs
NCBI-GeneID: 939131
NCBI-ProteinID: NP_390023
Pasteur: BG13591
BSORF: BG13591
UniProt: O31981
Position
2262437..2263261
Genome map
AA seq 274 aa AA seqDB search
MARKISDYHLKKREETQKKFIDLLAQNNYIHISGDMVNSKTKVKVRCRHNHTWQVNYEHF
KKGTRCPECRIIEGSLKKRLNISTVKSRYALKGYEILSTYKNCHSKLKAKCPEGHIWEHL
PSNFFKGEECFQCKGAKKYTVECAQAAFSDRGFIPLFDTYHHNKENLPFLCKEHIDLGVQ
YAPLHNMVRGLANCRKCYLLLFTGENSSRWKGGISSLNKTLREAVYEVWTKPSLEKYSFK
CAITNSTKDLHVHHYKKNFSEIVKEALSNLSFEL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagatatcagattatcatttaaaaaaacgtgaagaaactcaaaagaaattt
attgatttattagctcagaataactacattcacatttctggagacatggtaaattcgaaa
acaaaggtgaaagtcagatgtcgacataatcacacatggcaagtaaactacgaacacttt
aaaaaaggtactcgttgtccagaatgcaggataattgaaggctcccttaaaaaaaggctt
aacataagtactgtgaaaagtagatatgcccttaaaggctatgagattttaagcacctat
aaaaactgtcattctaaactaaaagctaagtgccctgaaggacatatatgggagcacctt
cccagcaacttctttaaaggtgaagagtgttttcaatgtaaaggtgctaaaaaatacact
gttgaatgtgcacaagcagctttttctgatcgtgggtttatccctttattcgatacatac
catcacaataaagaaaatctcccttttctatgcaaggaacatatagacttaggagttcaa
tacgctccacttcataacatggtaagaggtttagcaaactgcagaaagtgttatttactt
cttttcacaggcgaaaatagctctagatggaaaggcggtatttcttcgttaaataaaact
ttaagagaagctgtttatgaagtttggacgaagccctcattagagaaatattcatttaaa
tgtgcaataacaaactctacaaaagaccttcatgtgcaccactataaaaagaattttagc
gagattgttaaagaagcactgagcaatttaagttttgaactctaa

DBGET integrated database retrieval system