KEGG   Bacillus subtilis subsp. subtilis 168: BSU21420Help
Entry
BSU21420          CDS       T00010                                 

Gene name
bhlA
Definition
(RefSeq) holin BhlA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_BhlA
Motif
Other DBs
NCBI-GeneID: 939132
NCBI-ProteinID: NP_390025
Pasteur: BG13589
BSORF: BG13589
UniProt: O31983
Position
2264680..2264892
Genome map
AA seq 70 aa AA seqDB search
MEMDITQYLSTQGPFAVLFCWLLFYVMKTSKERESKLYNQIDSQNEVLGKFSEKYDVVIE
KLDKIEQNFK
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggatataacacaatatttaagtacccaggggccatttgctgttttattttgt
tggctacttttctacgtaatgaaaactagtaaggaaagagagtcgaaactttataatcaa
atcgattctcaaaacgaagtactgggtaaattcagtgaaaagtacgatgttgtaattgaa
aagctagataaaatcgaacaaaattttaagtag

DBGET integrated database retrieval system