KEGG   Bacillus subtilis subsp. subtilis 168: BSU21430Help
Entry
BSU21430          CDS       T00010                                 

Gene name
bhlB
Definition
(RefSeq) holin-like bacteriophage SPbeta protein BhlB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1
Motif
Other DBs
NCBI-GeneID: 939127
NCBI-ProteinID: NP_390026
Pasteur: BG13588
BSORF: BG13588
UniProt: O31984
Position
2264903..2265169
Genome map
AA seq 88 aa AA seqDB search
MFENIDKGTIVRTLLLAIALLNQIMVMLGKAAFIINEEDINHLYDCLYTIFTIVFTTSTT
TAAWFKNNYITAKGKKQKQVLKKENLFK
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaatattgataaaggcacaattgttaggactcttttgctcgcaatagcttta
ctcaatcaaataatggtgatgctgggtaaagcagcattcatcattaacgaagaggacata
aatcatttatatgattgtttatatacaattttcactatcgtcttcacaaccagtactact
accgcagcatggttcaaaaacaattacataactgcaaaaggaaaaaaacaaaaacaagtt
ctaaaaaaagagaacttgtttaaatag

DBGET integrated database retrieval system