KEGG   Bacillus subtilis subsp. subtilis 168: BSU21440Help
Entry
BSU21440          CDS       T00010                                 

Gene name
bdbB
Definition
(RefSeq) disulfide bond formation protein B
  KO
K03611  disulfide bond formation protein DsbB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU21440 (bdbB)
Chaperones and folding catalysts [BR:bsu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   BSU21440 (bdbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbB DUF2254 VKOR
Motif
Other DBs
NCBI-GeneID: 939128
NCBI-ProteinID: NP_390027
Pasteur: BG13587
BSORF: BG13587
UniProt: P68571
Position
complement(2265225..2265671)
Genome map
AA seq 148 aa AA seqDB search
MNTRYVKSFFLLLFFLSFFGTMASLFYSEIMHFKPCVLCWYQRIFLYPIPIILLIGLLKK
DLNSIFYVVFLSSIGLIIAFYHYIIQLTQSKSVVCEIGTNSCAKIEVEYLGFITLPLMSS
VCFALIFGIGLKLIIKSKKLKQNQHVYN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaagatatgtaaaatcattttttttattactgttttttctctctttctttggc
acaatggctagtttattctacagtgagatcatgcatttcaaaccatgtgttctatgttgg
tatcaaagaatatttctatatcctatacctattatcttactaataggcttattaaaaaaa
gatcttaattcgatattttatgttgttttcctttcatcaattggattgattattgcgttt
tatcattatattatccaacttacacaaagcaaaagtgtcgtatgtgaaattggaaccaac
agctgcgcaaaaattgaagtagagtatctaggctttattacattacccttaatgagttca
gtatgttttgcattgatatttggtataggactgaaattaattatcaaaagcaagaaatta
aaacaaaatcaacatgtatataattga

DBGET integrated database retrieval system