KEGG   Bacillus subtilis subsp. subtilis 168: BSU21440
Entry
BSU21440          CDS       T00010                                 

Gene name
bdbB
Definition
(RefSeq) disulfide bond formation protein B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DsbB VKOR DUF2254
Other DBs
NCBI-GeneID: 939128
NCBI-ProteinID: NP_390027
Pasteur: BG13587
BSORF: BG13587
UniProt: P68571 A0A6M3ZD22
Position
complement(2265225..2265671)
AA seq 148 aa
MNTRYVKSFFLLLFFLSFFGTMASLFYSEIMHFKPCVLCWYQRIFLYPIPIILLIGLLKK
DLNSIFYVVFLSSIGLIIAFYHYIIQLTQSKSVVCEIGTNSCAKIEVEYLGFITLPLMSS
VCFALIFGIGLKLIIKSKKLKQNQHVYN
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaatacaagatatgtaaaatcattttttttattactgttttttctctctttctttggc
acaatggctagtttattctacagtgagatcatgcatttcaaaccatgtgttctatgttgg
tatcaaagaatatttctatatcctatacctattatcttactaataggcttattaaaaaaa
gatcttaattcgatattttatgttgttttcctttcatcaattggattgattattgcgttt
tatcattatattatccaacttacacaaagcaaaagtgtcgtatgtgaaattggaaccaac
agctgcgcaaaaattgaagtagagtatctaggctttattacattacccttaatgagttca
gtatgttttgcattgatatttggtataggactgaaattaattatcaaaagcaagaaatta
aaacaaaatcaacatgtatataattga

DBGET integrated database retrieval system