KEGG   Bacillus subtilis subsp. subtilis 168: BSU21450Help
Entry
BSU21450          CDS       T00010                                 

Gene name
yolJ
Definition
(RefSeq) glycosyltransferase SunS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_4 Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 939123
NCBI-ProteinID: NP_390028
Pasteur: BG13586
BSORF: BG13586
UniProt: O31986
Position
complement(2265668..2266936)
Genome map
AA seq 422 aa AA seqDB search
MKLSDIYLELKKGYADSLLYSDLSLLVNIMEYEKDIDVMSIQSLVAGYEKSDTPTITCGI
IVYNESKRIKKCLNSVKDDFNEIIVLDSYSTDDTVDIIKCDFPDVEIKYEKWKNDFSYAR
NKIIEYATSEWIYFIDADNLYSKENKGKIAKVARVLEFFSIDCVVSPYIEEYTGHLYSDT
RRMFRLNGKVKFHGKVHEEPMNYNHSLPFNFIVNLKVYHNGYNPSENNIKSKTRRNINLT
EEMLRLEPENPKWLFFFGRELHLLDKDEEAIDYLKKSINNYKKFNDQRHFIDALVLLCTL
LLQRNNYVDLTLYLDILETEYPRCVDVDYFRSAILLVDMQNKLTSLSNMIDEALTDERYS
AINTTKDHFKRILISLNIQLENWERVKEISGEIKNDNMKKEIKQYLANSLHNIEHVLKGI
EV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagtgatatttatttggaattaaagaaaggctatgccgattctttattgtat
tcagatttgtcattgttggttaatataatggaatatgaaaaagatattgatgtgatgtca
attcaatctttggttgcaggttatgaaaaatcagatactcctacaataacatgcggtatt
atagtttataacgaaagcaagagaattaaaaagtgtttaaatagtgttaaagatgatttt
aacgagattattgttctagattcatactccactgatgataccgttgatattattaaatgt
gattttcctgatgttgaaattaaatatgaaaagtggaagaatgatttttcctatgctaga
aataaaattatagagtatgctacttccgaatggatttattttattgatgcagataattta
tactctaaagaaaacaaagggaaaatagctaaagtagctagagttttagagtttttttct
attgattgtgtagttagtccatatatagaagaatatactggacatctatattctgataca
cgaagaatgtttcggctcaatggtaaagttaaatttcatgggaaagtgcatgaagaacct
atgaattataatcatagtctaccttttaatttcattgtgaaccttaaggtttaccataat
ggatataatccttcagagaataatataaaatcaaaaacacgaaggaatataaatctcaca
gaagaaatgttaagattggagcccgaaaacccaaaatggttattctttttcggcagagaa
ctacatttacttgataaagatgaagaagcaattgattatctgaaaaaatcaataaacaac
tataaaaaatttaatgatcaaagacattttatagatgctttagtgctattatgtacttta
ttattgcagagaaataattatgttgacttaactttatatttggatatattggaaactgaa
tatccaagatgtgttgatgttgattactttagatctgcaattttgttagtagatatgcaa
aataaacttacttctttaagcaatatgattgatgaagctcttacagacgagagatacagt
gctataaatacaacaaaagatcactttaaaagaattttaataagccttaatattcaactc
gaaaattgggaaagagtaaaagaaatatcaggggaaattaaaaatgataatatgaaaaaa
gaaattaaacaatatcttgccaactcactccacaatattgaacacgtcctgaaaggaatt
gaagtatga

DBGET integrated database retrieval system