KEGG   Bacillus subtilis subsp. subtilis 168: BSU21460Help
Entry
BSU21460          CDS       T00010                                 

Gene name
bdbA
Definition
(RefSeq) disulfide bond formation protein A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_3 TraF AhpC-TSA DUF836 Redoxin Thioredoxin_8 FtsH_ext OST3_OST6 DUF443 DUF2847 Glutaredoxin DUF3139 SUR7
Motif
Other DBs
NCBI-GeneID: 939129
NCBI-ProteinID: NP_390029
Pasteur: BG13585
BSORF: BG13585
UniProt: P68569
Position
complement(2266936..2267349)
Genome map
AA seq 137 aa AA seqDB search
MKKWIVLFLVLIAAAISIFVYVSTGSEKPFYNDINLTQYQKEVDSKKPKFIYVYETSCPP
CQEIKPELNEVIKKEKLKVQALNIEEKENYNTEFLDKYNLNKTPTILYYKDGKEKDRLEG
YRSASQIEKFFDKNGDR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtggattgttttatttcttgttttaatagcagcagccattagtattttcgtt
tatgtttctacaggtagcgaaaaacctttttataatgatataaatttaactcaatatcaa
aaagaagtagactctaaaaaacctaaatttatttatgtttatgagacaagttgtcctcct
tgtcaagaaataaaacctgagttaaatgaagtaattaaaaaagaaaagttaaaagtacag
gctttaaatattgaagaaaaggaaaattataacactgaatttttagataaatataatttg
aataaaactccaacgattctctattacaaagatggcaaagaaaaagatcggttagagggc
tatagaagtgcaagccaaatagaaaagttctttgataaaaatggtgatagataa

DBGET integrated database retrieval system