KEGG   Bacillus subtilis subsp. subtilis 168: BSU21490
Entry
BSU21490          CDS       T00010                                 

Gene name
sunI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: bPH_4 bPH_5
Other DBs
NCBI-GeneID: 939125
NCBI-ProteinID: NP_390032
Pasteur: BG13584
BSORF: BG13584
UniProt: O31989
Position
complement(2269988..2270305)
AA seq 105 aa
MEYVVMIIILLALFFIFTVFLNTRYSFDEKCLVLKFGLSKTEIPINQIVSIKESDKYGVA
DNIDYKIGMPYAQPDRIVIETTNKRFLVFLNGAQQFIQKYKRVSV
NT seq 318 nt   +upstreamnt  +downstreamnt
atggaatatgtagttatgataatcattttattagcacttttctttatttttactgttttc
ctaaatacacgttatagttttgatgaaaaatgcttagtcttaaaatttggtttatctaaa
acagaaattccaattaatcaaatagttagtattaaagagtcagacaagtatggagttgca
gataatatcgattataaaattggtatgccatatgctcaaccagatagaattgttattgaa
actacaaataagcgttttctagtttttttaaatggagctcaacaatttattcaaaagtat
aaaagggttagtgtttga

DBGET integrated database retrieval system