KEGG   Bacillus subtilis subsp. subtilis 168: BSU21500Help
Entry
BSU21500          CDS       T00010                                 

Gene name
uvrX
Definition
(RefSeq) UV-damage repair protein UvrX
  KO
K03502  DNA polymerase V
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU21500 (uvrX)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    BSU21500 (uvrX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMS IMS_C IMS_HHH
Motif
Other DBs
NCBI-GeneID: 939122
NCBI-ProteinID: NP_390033
Pasteur: BG12698
BSORF: BG12698
UniProt: O31990
Position
complement(2270407..2271657)
Genome map
AA seq 416 aa AA seqDB search
MIDYSQFPRKNILCVDMKSFYASVSAVTMGLNPLTCYLAVVGNTDRQGSVVLAASPALKK
DFGIKTGSRLFEIPEDPRIHIVNPQMKLFIRVSTEITKLFYRFVPEKCVHTYSIDESFLD
AGKEDPEEMAKAIQSSMWREFGLMCTVGIGDNMLLSKLALDLESKKTKSGIARWRYEDVP
NKLWKVRPLSKMWGIGGRMERNLNRMGISTIGQLAKFPLELLEKKFGIMGNQLYYHAHGI
DLSEIGAPLMQGQISFGKSQILLRDYTRSEEIKAVLLEICEEVARRARTHNKVGRTISLG
IGYSKDELGGGFHRSKTIDLPTSITMDIYRCCLMLFNKFYSGKTVRSVSVTLSNIEDDVN
QQLSLFEVDNEKRRKLGFVMDGIRSKYGSKAILRAVSYTPAGTALQRAGLTGGHKS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgattgattactcacaatttccacgtaagaatatactttgtgtcgatatgaaatccttt
tatgcttctgtatcggctgtaacaatggggcttaaccctttaacatgctatcttgctgtt
gtagggaatacggatagacagggaagtgtagtgttagctgcatctcctgcacttaaaaaa
gattttggaatcaaaacaggatcgagactatttgagatacctgaagatccaagaatacac
attgtaaatccacaaatgaagcttttcatcagagtttcaactgaaattacaaagctgttt
tacagatttgttcctgagaaatgtgtccatacgtattcaattgatgaatcttttttagat
gcaggaaaagaagatcctgaagaaatggccaaagcaatccaaagcagcatgtggagagaa
tttggtttgatgtgcacagttggtattggagacaatatgctactcagtaagcttgcactt
gacctggagagtaagaaaacaaagagtggcattgcacgttggagatatgaagatgtacca
aataaactctggaaggttcgccctttgtctaaaatgtgggggataggagggaggatggaa
agaaacctaaatcggatgggaatatcgactataggtcagttagccaaatttcctttagag
ctgcttgaaaagaagttcggaataatgggaaaccagttgtactaccatgctcacggaatt
gatttatcagaaataggtgctccgttgatgcaaggtcagattagtttcggtaagagtcag
attttactgagggattacacaaggagtgaagagattaaggcggttcttctggagatttgt
gaagaagtcgcaagaagggcacgtacacataataaagttggtcgaacaatcagtctggga
attgggtacagtaaggatgagcttggtggtggttttcatcgttccaaaacaattgatctt
cctacaagtatcacgatggatatttatagatgctgcttgatgctttttaataagttttac
tcgggtaagactgtgagaagtgtctcagtcacgttatcgaatattgaggatgatgttaat
cagcagctgagtttatttgaagtggataatgaaaagagaaggaaactcggttttgtaatg
gatgggattagaagtaaatacggctctaaagcgattctgagagcagtttcttatacacca
gcaggaactgcacttcaacgagctggattaacaggtgggcataagagttaa

DBGET integrated database retrieval system