KEGG   Bacillus subtilis subsp. subtilis 168: BSU21510Help
Entry
BSU21510          CDS       T00010                                 

Gene name
yolD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YolD
Motif
Other DBs
NCBI-GeneID: 939126
NCBI-ProteinID: NP_390034
Pasteur: BG13583
BSORF: BG13583
UniProt: O31991
Position
complement(2271650..2271982)
Genome map
AA seq 110 aa AA seqDB search
MLRDRGTIKWTSMMLPEHLTQLKQDLIDVSKIEKPSLDDQQIEEMDILVSEALEFNKELQ
FKLFHNGFVENVTGRVHYINFEQQKLHVKDQNDNTVYINMNNIIGVTYND
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcttagagatcgaggaacaatcaaatggacatcaatgatgcttccagaacatttgaca
cagcttaaacaagatttgattgatgtatcaaaaattgaaaagccatccttagatgatcaa
caaattgaagagatggatattctcgtctctgaggcacttgaatttaacaaagagttgcaa
tttaaactttttcacaatggattcgttgaaaatgtcaccggcagagtccattacataaat
tttgaacaacaaaagcttcacgtaaaagaccagaatgacaatacagtttatatcaacatg
aataacatcataggagttacatacaatgattga

DBGET integrated database retrieval system