KEGG   Bacillus subtilis subsp. subtilis 168: BSU21520Help
Entry
BSU21520          CDS       T00010                                 

Gene name
yolC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4252 Docking
Motif
Other DBs
NCBI-GeneID: 939120
NCBI-ProteinID: NP_390035
Pasteur: BG13582
BSORF: BG13582
UniProt: O31992
Position
2272156..2272491
Genome map
AA seq 111 aa AA seqDB search
MKKRLIGFLVLVPALIMSGITLIEANKKSPLEVIDNIRDEFGIFSVQIGQTDPAITIGMD
QTKSEAKLREYLKDNLSREAKEKYKIYILKDDINKLEKEHREYLKANNPNK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaggctaatcggatttttggtcttagttcctgctttgattatgtcaggtatt
actttaatcgaagcaaataaaaagtcccctttggaagtaattgataatattcgggatgaa
tttggtatattcagtgtgcaaattggtcaaacagatccggcaattacaattggcatggat
caaaccaaaagtgaagcaaagctccgtgagtatttaaaagataatctgtctagagaagca
aaggaaaaatataagatctatatattaaaagatgatattaataaattggagaaagaacat
cgagagtatttgaaagcaaataaccccaataagtaa

DBGET integrated database retrieval system