KEGG   Bacillus subtilis subsp. subtilis 168: BSU21530Help
Entry
BSU21530          CDS       T00010                                 

Gene name
yolB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LETM1
Motif
Other DBs
NCBI-GeneID: 939119
NCBI-ProteinID: NP_390036
Pasteur: BG13581
BSORF: BG13581
UniProt: O31993
Position
complement(2272534..2272890)
Genome map
AA seq 118 aa AA seqDB search
MISTSNYDVTKDPKFLAFCSLATEGYGQNNTQQSSIGFNEFCEKLEKNAIVKPENKKSTL
DLNKSLEDWKLRFTAGGNLSTMDSQVLDVIKKAYNLGMVNKDNMLLRNEAINAYRNSI
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtacttctaattatgatgtaactaaagatccaaaattcttagctttttgtagc
ttagcaacagaagggtatggacagaacaatactcagcaatcttcaataggttttaacgag
ttttgcgaaaaacttgagaaaaatgcgatcgttaaacccgagaataaaaaaagcacgctt
gatttgaataagtctttagaagactggaaattgagatttactgcaggcggaaacctttct
acaatggattcgcaggtattagatgttatcaaaaaagcttataacttaggcatggttaat
aaagataatatgctattacgaaatgaagcaattaatgcttatagaaattctatttaa

DBGET integrated database retrieval system