KEGG   Bacillus subtilis subsp. subtilis 168: BSU21540Help
Entry
BSU21540          CDS       T00010                                 

Gene name
yolA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4879 BetaGal_dom3
Motif
Other DBs
NCBI-GeneID: 939117
NCBI-ProteinID: NP_390037
Pasteur: BG13580
BSORF: BG13580
UniProt: O31994
Structure
PDB: 

Position
complement(2272896..2273363)
Genome map
AA seq 155 aa AA seqDB search
MKKRITYSLLALLAVVAFAFTDSSKAKAAEALPLYYLQITGITSDGNDFAWDNLTSSQTK
APNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKY
FEIPMDALQDNSIQIKALSSGTTFVYSQKIDFERE
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagagaattacatattcactgcttgctcttctagcagttgttgctttcgctttc
actgattcatcaaaagcaaaagcggcagaagcattaccactctactatctacaaattaca
gggattacatcagacggaaacgattttgcttgggataacctcacttctagtcaaaccaag
gcgccaaacgttttgaaggggaataaactatatgtgaaagctcgttttatgggttatacc
aagttaacagttatcacaggcaaagacggtaagaatctgttgtataacggtacagctaaa
atgtttaaatctgatgctatccttggtcaaaataaggtggtaataggctgggataaatat
tttgagattcccatggacgcacttcaagataactctatacagattaaagcattgagctca
ggcaccacttttgtttacagtcaaaaaattgattttgaaagagagtga

DBGET integrated database retrieval system