KEGG   Bacillus subtilis subsp. subtilis 168: BSU21550
Entry
BSU21550          CDS       T00010                                 

Gene name
yokL
Definition
(RefSeq) N-acetyltransferase YokL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_4 Acetyltransf_10 Acetyltransf_7 Acetyltransf_8 FR47 Acetyltransf_9 Lipoprotein_16
Other DBs
NCBI-GeneID: 939118
NCBI-ProteinID: NP_390038
Pasteur: BG13579
BSORF: BG13579
UniProt: O31995 A0A6M3ZDI5
Position
complement(2273989..2274522)
AA seq 177 aa
MAVTYWTGENLTLRAIQPEDIVIFDSLDDEILRNMDSLHFPRSANNMREWVEEQLEKDEF
RFIAVESDNNIVGMIETFDCDRKNGTFGYYLAVFEPYRGKGFAKEMILMVLRFFFLELAY
QKVNTTVYSFNNPSIRLHEKLGFMKEGQLRKIIFTKGAYYDGICFGMTREEFELNHG
NT seq 534 nt   +upstreamnt  +downstreamnt
atggcagttacttattggacaggggagaatcttacactgcgagcaattcaacctgaagat
atcgttatatttgattcgttagatgatgaaattctgcgaaatatggactcgctacatttt
cctcgttcagctaataacatgagagaatgggtagaagaacaattagaaaaagatgaattc
cgttttattgcagttgaaagtgataataatatagtaggtatgattgaaacctttgactgt
gataggaaaaatggtaccttcggttattatttggctgtattcgagccatataggggcaaa
ggatttgccaaagaaatgatcttgatggttcttcgctttttctttttggaacttgcttat
caaaaagtaaatacaactgtttattcttttaataatccatccatacgattacatgaaaaa
ttaggtttcatgaaagagggacaactaagaaagatcattttcactaaaggtgcctattat
gatggtatttgctttgggatgacaagagaagaatttgaactgaatcatggataa

DBGET integrated database retrieval system