KEGG   Bacillus subtilis subsp. subtilis 168: BSU21560Help
Entry
BSU21560          CDS       T00010                                 

Gene name
yokK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUKH_6 SMI1_KNR4 SUKH_5 SUKH-3 T2SSG
Motif
Other DBs
NCBI-GeneID: 939116
NCBI-ProteinID: NP_390039
Pasteur: BG13578
BSORF: BG13578
UniProt: O31996
Position
complement(2274558..2275136)
Genome map
AA seq 192 aa AA seqDB search
MSFTKIEQKLKEFTIDAGRYPSINTNEQLKELEMNIGNQLPSDYKDFLKKYGGCYLESKK
TTDEIEYDVCYKPLEKDPWMGKGDDTQLLEGFYGLANDHNSLQKAIDTYSDRFPRNIIPI
ASSAGGNEICMDIDNGKILFWDHELSHPDKDFFLIANSFEEFVFSLVDEPIEADKEDDGI
LYIELDDDLLSS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcactaagatcgaacaaaagttgaaagagtttacgattgatgctggcagatat
cctagcattaatacaaatgaacaactcaaagagcttgaaatgaacataggcaatcaatta
ccttcagattataaggactttttgaagaaatatggaggatgttatttagaaagtaaaaaa
acaacagatgagattgagtatgacgtttgctataaacctttagagaaagatccatggatg
ggcaagggcgatgatacacaattgttagaaggtttttatggtttagcgaatgatcataac
agtcttcagaaagcaatcgatacatattctgatcgctttcctagaaatattattcctatc
gcaagctctgcaggcgggaatgaaatatgcatggatatcgataatggaaagatattgttt
tgggatcatgaattaagtcatcccgacaaagactttttcttaattgccaattcgtttgag
gagtttgtcttcagtttagttgatgaaccaattgaagctgataaagaagatgatggaatt
ctgtatattgaattagatgatgacttactaagcagttaa

DBGET integrated database retrieval system