KEGG   Bacillus subtilis subsp. subtilis 168: BSU21570
Entry
BSU21570          CDS       T00010                                 

Gene name
yokJ
Definition
(RefSeq) hypothetical protein
  KO
K21490  antitoxin YokJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU21570 (yokJ)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YokI-YokJ
    BSU21570 (yokJ)
SSDB
Motif
Pfam: SMI1_KNR4 SUKH_6
Other DBs
NCBI-GeneID: 939114
NCBI-ProteinID: NP_390040
Pasteur: BG13577
BSORF: BG13577
UniProt: O31997 A0A6M3ZD68
Position
complement(2275200..2275697)
AA seq 165 aa
MSIDMLIKKIASTSDCRLFEADGLPVIDEKHQLPKDISEFYEQCGGAVLYENADYPIYIV
RPAEFELANPIIVGELCEEDISSEWYIVCTDGKGEYLTIDLNDQRKGKCYDSFFDRHGIV
GETQVIASSFTDLIQRLLENKGKHWYWLRDDYVSLGDAYDGIEIE
NT seq 498 nt   +upstreamnt  +downstreamnt
ttgagcattgacatgttaatcaagaagattgcttctacatcagactgtcggctgtttgaa
gctgatggtctcccagtaatagacgagaagcatcaactaccaaaagatattagtgaattt
tatgaacaatgtggtggagcagttttatatgaaaatgcggattatccaatatacatagta
cgaccagctgagtttgaattagctaatcccattattgttggggagctctgtgaagaagac
atttcatccgagtggtatattgtttgcacggatggaaaaggagaatacctaacaattgac
ttaaacgatcagcgaaaaggaaaatgctatgacagtttttttgatcgacatggaatagtc
ggcgaaacacaggtgatagcaagttcatttacagatttaatacagcgactgcttgaaaat
aagggtaaacattggtattggttaagggatgattatgtatcactaggcgatgcatatgat
ggcatagaaattgaataa

DBGET integrated database retrieval system