KEGG   Bacillus subtilis subsp. subtilis 168: BSU21580Help
Entry
BSU21580          CDS       T00010                                 

Gene name
yokI
Definition
(RefSeq) hypothetical protein
  KO
K21489  toxin YokI [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU21580 (yokI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU21580 (yokI)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YokI-YokJ
    BSU21580 (yokI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LXG Tox-SHH Nif11 DUF3106
Motif
Other DBs
NCBI-GeneID: 939115
NCBI-ProteinID: NP_390041
Pasteur: BG13576
BSORF: BG13576
UniProt: O31998
Position
complement(2275706..2277421)
Genome map
AA seq 571 aa AA seqDB search
MKVFEADSLLSEADKRTKEYKELRSQMVKLKKAFKAVADLDDSKFSGKGADNIKAFYHDH
VGVTDQWIDLIDMKIVFLSSISAKLEDAKMSDAYIEESFLEHELVNAYTKSKSIMSEQKK
AMKDILNDINDILPLEIFSTEDFKDKLSSADDKREKTIDKINKLDEDLKTEYAETEQNEQ
FIQQDFKKLQESTGKGKNATPIHYSAKAYRESDIHKKKGDIEQHSEAYLTVKKEEAKERE
IKELKKKLNDGVSDPDEYLEIAKKVGYENLEPAQVQLAVQIEQAKQLEGAGEITWDIVKG
VGVGLYDVGKDTVTGLWDFITDPGETLSALGNAVIHPVKTYDAISAAIEESYQKDMVNGD
AYSRSRWVTYAIGSVAAAVIGTKGAGAINKADAAGKVINKASQAGKKIKDVKIPDLLPYN
PKYDLAMAGDVPYNVVDGENLKNQLMSFAKGSDKEVKPFDVVDYRPSNSPLENHHGVMDV
WAKHNVPNYVSRGSNTPTVALTKEQHNATKKVYREWLFEKTGKKVGGKVNWKEVSPREIQ
ELTEKMFDAANVPKEARQQYYNAFNQYNFRK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtatttgaagctgattcattgctctctgaagcggataaaagaaccaaagagtat
aaggaactaaggtcgcaaatggtgaagctcaaaaaagcgtttaaagctgtagctgaccta
gacgacagcaagttttcaggtaagggtgcagacaacattaaagcattttatcatgaccat
gtcggcgttacagatcaatggattgatcttatcgatatgaaaattgttttcttaagcagc
atttctgcaaaacttgaagacgctaagatgtctgatgcatacatagaagaatccttctta
gaacatgaacttgtaaatgcatacacaaaatcaaaatccattatgtctgaacagaaaaaa
gcaatgaaagacattttaaacgacatcaatgatattcttccacttgaaatattctcaaca
gaagacttcaaagacaaactttcctctgcagatgacaaacgtgaaaaaacaatcgataag
ataaacaagcttgatgaggatttaaaaacagagtacgctgagactgaacaaaatgaacaa
ttcatccagcaagattttaaaaagctgcaggaatcaacaggcaaagggaagaacgccaca
ccgattcactatagcgccaaagcgtatagagaaagtgacatacataagaaaaaaggcgat
attgagcagcattcagaagcttatttaaccgtgaagaaagaagaagcaaaggaacgtgaa
atcaaggaattaaagaaaaaacttaatgacggtgtgtctgatcctgatgaatatttagag
attgctaagaaagtagggtacgagaatctggagccagctcaagtacagcttgcagtgcaa
attgaacaagcaaagcagctagaaggagcaggagaaatcacctgggacatcgtaaaaggt
gtaggggtaggcttatatgacgttggcaaagacactgtaaccggcttatgggacttcatc
accgatccaggagaaacattgtcagcgcttggcaatgcagttattcatccagttaaaaca
tatgatgcaatatctgctgcaattgaagagtcatatcaaaaggatatggtgaatggagat
gcctattcaaggtcaagatgggtaacgtatgcaattggctcagtggctgcagctgttatc
ggaacaaaaggtgcaggagccattaacaaagctgatgcagcaggcaaggtaataaataaa
gctagtcaagcagggaagaaaattaaggacgtcaagattccagatttgctgccttataac
cctaagtacgatcttgctatggcaggggacgtgccatacaatgtagtggatggagaaaac
ttaaaaaatcagctaatgagttttgctaaagggtcagataaagaagtaaaacctttcgat
gtcgttgattatagaccaagtaacagtcctttagagaatcatcacggtgtaatggacgta
tgggctaaacacaatgttccgaattatgtgagtagagggagtaacacaccaacagtagct
ttaactaaggaacaacacaacgctaccaagaaagtatatagagaatggttgttcgaaaaa
acagggaagaaagttggcggcaaagtaaactggaaagaagtatcccccagagaaatacaa
gaacttactgagaagatgtttgatgctgctaatgttcctaaagaagctagacagcaatat
tataacgcatttaatcaatacaactttagaaagtag

DBGET integrated database retrieval system