KEGG   Bacillus subtilis subsp. subtilis 168: BSU21590Help
Entry
BSU21590          CDS       T00010                                 

Gene name
yokH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMI1_KNR4 SUKH_6 SUKH_5
Motif
Other DBs
NCBI-GeneID: 939111
NCBI-ProteinID: NP_390042
Pasteur: BG13575
BSORF: BG13575
UniProt: O31999
Position
complement(2277521..2278078)
Genome map
AA seq 185 aa AA seqDB search
MTNFVHKTVNGLKSLLDEKGAIQLFCSEGDIMEFLVTFSPDKATLNDIQSFEAKHQLSLP
EDYQKFITLHNGAKIFEILSDGENIGGGLQLFSLEEIEEELKYEDLFEGINGIPIGYLLE
ECHLMIDKDKINQGDPNYLYIFESGLEYNPLNLNFEIFLDRYILANGEPFWDWRYYTAEN
YYRTR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgactaactttgttcataagacggtaaatggcttgaaaagtcttttagatgaaaaagga
gccattcaattgttttgttcagaaggtgatatcatggagttccttgttacattttcaccg
gacaaagcaaccctgaatgacattcaaagctttgaggctaaacaccagctttcccttcca
gaggattatcagaagttcatcacactacataacggtgcgaaaatttttgagattctttct
gatggggagaatataggtggaggacttcagctatttagccttgaagagattgaagaggaa
ctaaaatatgaggatttgtttgaaggtatcaatggtatcccaattggctacttattggaa
gaatgccatttaatgatcgataaagataaaattaatcaaggtgatcctaactatctctat
atatttgaaagtggtttagaatataatccattaaatttaaactttgaaatatttttagac
cggtatatattggctaatggggaacctttttgggattggcgctactataccgcagaaaat
tattatagaacaagatag

DBGET integrated database retrieval system