KEGG   Bacillus subtilis subsp. subtilis 168: BSU21610Help
Entry
BSU21610          CDS       T00010                                 

Gene name
yokF
Definition
(RefSeq) endonuclease
  KO
K01174  micrococcal nuclease [EC:3.1.31.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU21610 (yokF)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.31  Endoribonucleases that are active with either ribo- or deoxyribonucleic acids and produce 3'-phosphomonoesters
    3.1.31.1  micrococcal nuclease
     BSU21610 (yokF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNase Excalibur CAC1F_C ETRAMP
Motif
Other DBs
NCBI-GeneID: 939113
NCBI-ProteinID: NP_390044
Pasteur: BG13573
BSORF: BG13573
UniProt: O32001
Position
2279977..2280867
Genome map
AA seq 296 aa AA seqDB search
MKKVLLGFAAFTLSLSLAACSSNDSEKVSTEKETPQASTDVEKKTEQKESTKEKTADKSK
EKDKKELVDVTLDRAVDGDTIKVTYNGNVDTVRYLLIDTPETKKPNSCVQPYGEDASKRN
KELVNSGKLQLEFDKGDRRDKYGRLLAYVYVDGKSVQETLLKEGLARVAYVYEPNTKYID
QFKKDEQEAKSEKLSIWSKNGYVTDRGFNGCVKEKTTAVKKATTSKPAATQPTTPKASSE
TSTTTEKEASSETTGGTETFKNCTELRKKYPNGVPSSHPAYQSKMDRDHDNYACER
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaagtattattaggttttgcagcattcactttgagcttatcgttggcagcctgc
agctcaaatgattctgaaaaagtaagcacagaaaaagaaacaccacaagcgtctacggat
gtggaaaagaaaacagaacaaaaggaatctactaaagaaaaaactgctgacaagtctaag
gaaaaagacaaaaaggaattggtcgatgttactctagatagagctgttgatggtgacaca
attaaagttacctacaacggaaatgtagacacagtacgctacttgctcatagacacacct
gaaacaaagaaaccaaattcttgtgttcaaccatatggtgaggatgcgtcaaaacgaaat
aaagaattggtcaacagtggtaagctgcagcttgaatttgacaaaggtgatcgcagagat
aaatacggaagactattagcttatgtttatgtggatggcaaatctgttcaggaaacattg
ctaaaagaaggattggccagagtagcgtatgtatatgagccaaatacgaaatacatagat
caatttaagaaagacgagcaagaagcaaaatcagagaagctttcaatctggagcaagaat
ggatatgtgactgaccgaggatttaatggctgtgtgaaagagaaaaccactgcagttaaa
aaagcaacaacatctaaaccggcagcaacacagcctacaactccaaaggcatcaagtgaa
acttcgactacaactgaaaaagaagcttcttcagagacaactggaggaacagaaacattt
aaaaattgcacagagttaagaaagaaatatccgaatggagtgcctagctcccaccctgct
taccaatctaaaatggacagggatcatgacaactatgcttgtgaacgatga

DBGET integrated database retrieval system