KEGG   Bacillus subtilis subsp. subtilis 168: BSU21620
Entry
BSU21620          CDS       T00010                                 

Gene name
yokE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: bPH_3 Rtt106
Other DBs
NCBI-GeneID: 939108
NCBI-ProteinID: NP_390045
Pasteur: BG13572
BSORF: BG13572
UniProt: O32002 A0A6M3ZD42
Position
2280881..2281363
AA seq 160 aa
MGQKFHKLNSKYGIIDYPILLKDLESIIQEFPKSERKFYEYAIKALKKEVGKKEKILHMT
SADPKLTKFGFMVITEKKLLFVTMKGGFFGGADTEVVEFKSIKEVDFDIAPNPLGMATMQ
LGILHLKIKGKLGMSSKRTIRNIDEHSLDKIVAILREQTK
NT seq 483 nt   +upstreamnt  +downstreamnt
atgggacaaaaatttcataaattaaactctaagtatggaatcatagattatccaatactt
ttaaaagatcttgagtccatcattcaagaattccctaaatcagaaagaaagttttatgag
tatgcaattaaagctttaaaaaaggaagttgggaaaaaggaaaagattttacatatgact
tctgcagatccaaagcttactaaatttggttttatggttatcactgaaaagaaacttcta
tttgtcactatgaaaggcggttttttcgggggtgcagatactgaagttgttgaatttaaa
agtatcaaagaagttgacttcgatattgctccaaatcccttgggaatggccacgatgcaa
ttgggtatcctccatttaaaaatcaaaggtaagcttggaatgagtagcaagcgtaccatt
agaaatattgatgaacattctcttgataaaatagtagctatactaagagagcaaacaaaa
taa

DBGET integrated database retrieval system