KEGG   Bacillus subtilis subsp. subtilis 168: BSU21620Help
Entry
BSU21620          CDS       T00010                                 

Gene name
yokE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bPH_3
Motif
Other DBs
NCBI-GeneID: 939108
NCBI-ProteinID: NP_390045
Pasteur: BG13572
BSORF: BG13572
UniProt: O32002
Position
2280881..2281363
Genome map
AA seq 160 aa AA seqDB search
MGQKFHKLNSKYGIIDYPILLKDLESIIQEFPKSERKFYEYAIKALKKEVGKKEKILHMT
SADPKLTKFGFMVITEKKLLFVTMKGGFFGGADTEVVEFKSIKEVDFDIAPNPLGMATMQ
LGILHLKIKGKLGMSSKRTIRNIDEHSLDKIVAILREQTK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaaaatttcataaattaaactctaagtatggaatcatagattatccaatactt
ttaaaagatcttgagtccatcattcaagaattccctaaatcagaaagaaagttttatgag
tatgcaattaaagctttaaaaaaggaagttgggaaaaaggaaaagattttacatatgact
tctgcagatccaaagcttactaaatttggttttatggttatcactgaaaagaaacttcta
tttgtcactatgaaaggcggttttttcgggggtgcagatactgaagttgttgaatttaaa
agtatcaaagaagttgacttcgatattgctccaaatcccttgggaatggccacgatgcaa
ttgggtatcctccatttaaaaatcaaaggtaagcttggaatgagtagcaagcgtaccatt
agaaatattgatgaacattctcttgataaaatagtagctatactaagagagcaaacaaaa
taa

DBGET integrated database retrieval system