KEGG   Bacillus subtilis subsp. subtilis 168: BSU21630Help
Entry
BSU21630          CDS       T00010                                 

Gene name
yokD
Definition
(RefSeq) AAC(3) family N-acetyltransferase
  KO
K00662  aminoglycoside 3-N-acetyltransferase [EC:2.3.1.81]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU21630 (yokD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.81  aminoglycoside 3-N-acetyltransferase
     BSU21630 (yokD)
Antimicrobial resistance genes [BR:bsu01504]
 Gene variants
  Aminoglycoside resistance genes
   N-Acetyltransferases
    BSU21630 (yokD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Antibiotic_NAT Molydop_binding
Motif
Other DBs
NCBI-GeneID: 939106
NCBI-ProteinID: NP_390046
Pasteur: BG13571
BSORF: BG13571
UniProt: O32003
Structure
PDB: 

Position
2281667..2282485
Genome map
AA seq 272 aa AA seqDB search
MKKIVESTTFPRTKQSITEDLKALGLKKGMTVLVHSSLSSIGWVNGGAVAVIQALIDVVT
EEGTIVMPSQSVELSDPKEWGNPPVPEEWWDIIRESMPAYNSNYTPTTRGMGQIVELFRS
YPEVKRSNHPNYSFVAWGKHKNKILNQHPLEFGLGEQSPLGKLYIRESYVLLLGADFDSS
TCFHLAEYRIPYQKIINRGAPIIVEGKRVWKEYKELEFREELFQEVGQAFEAEHNMKVGK
VGSANCRLFSLTEAVDFAEKWFINNDSKNIKK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagttgaaagtacaacttttccaagaacaaaacagtctataacagaagat
ttgaaagctttaggattaaagaaagggatgaccgtacttgtacattcctctttatcttct
ataggatgggtaaatggtggagctgttgctgtgattcaagcattaatagatgttgttact
gaagaaggtaccatcgtgatgccttctcaatccgtggaattatctgacccaaaagaatgg
ggaaaccctcccgtaccagaggagtggtgggatattattagagaaagtatgccagcctat
aattctaactatacccccactactagagggatggggcaaatagtagagttattcaggtct
tatccagaagttaaaagaagtaatcacccaaactactcctttgtagcttggggaaaacat
aaaaacaaaatccttaatcaacatcctttagaattcggactgggtgaacaatcacctctg
gggaaactttatatacgggaatcatatgtattattattaggtgctgattttgatagtagt
acctgcttccatcttgctgagtacagaattccttatcaaaaaattataaacaggggtgca
cctataatagtagaaggtaaaagagtatggaaagaatataaagaacttgaatttagagaa
gaactatttcaagaagtcggtcaagcgtttgaagcagaacataatatgaaagttggcaaa
gtgggttctgctaattgccgccttttttcacttacagaagcagtggattttgctgagaaa
tggtttattaataatgatagtaaaaatataaaaaaatag

DBGET integrated database retrieval system