KEGG   Bacillus subtilis subsp. subtilis 168: BSU21640
Entry
BSU21640          CDS       T00010                                 

Gene name
yokC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939109
NCBI-ProteinID: NP_390047
Pasteur: BG13570
BSORF: BG13570
UniProt: O32004 A0A6M3ZD78
Position
complement(2283136..2283651)
AA seq 171 aa
MDNRKMLLRQKLKINKQKSLRVTLMSTLPRDMATTIEDCSLITSPELERILDKVQKKWNF
ELHKNDFAIKYSEHRKEYSWEYEVINHVQQTKLPDEQVYLYLGIEDSPIFLINGNWIIEN
FNFLWEQINNSDLWIIDFNFKYGVLVSRYGGYLDHDPNPNEIIYAVTEWGI
NT seq 516 nt   +upstreamnt  +downstreamnt
atggacaatcgaaaaatgcttcttagacagaagttgaaaataaacaaacaaaaaagcctc
cgagtaacattgatgtcaacactgcctcgtgatatggcaactactattgaggattgtagt
ctaatcacatctcctgaattagaaagaatcctagataaagttcagaaaaaatggaacttt
gagttacataaaaatgattttgcaattaaatacagtgagcatagaaaagaatacagttgg
gaatatgaagtgatcaatcatgtgcaacaaactaagcttcctgatgaacaagtttactta
tatttagggatagaggatagcccaatttttctgattaacggtaactggataatagagaac
tttaattttctgtgggaacaaataaataacagcgatttatggattattgactttaatttt
aaatatggggttctagtgtctcgatatggcggatatttagatcatgatcctaacccaaat
gaaattatttatgcagtcactgaatgggggatataa

DBGET integrated database retrieval system