KEGG   Bacillus subtilis subsp. subtilis 168: BSU21650Help
Entry
BSU21650          CDS       T00010                                 

Gene name
yokB
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P63C O-antigen_lig
Motif
Other DBs
NCBI-GeneID: 939110
NCBI-ProteinID: NP_390048
Pasteur: BG13569
BSORF: BG13569
UniProt: O32005
Position
complement(2283858..2284568)
Genome map
AA seq 236 aa AA seqDB search
MNIRFSMLVCVSFIFFTGGCAESSANSNDGSKNKNESKEESSEEGVKENDNKLADTPNMD
DCIEVYGKEECEQITEYYKSEEGQKELDASETDKYSAKSQTSTTHKDIYEKVSWLVKEMF
GVPERTIPADYEKSLVEKRDDGLYYIQSSYEIKGTGNQADTYYEFEMLMDNKYNLIDAYF
PGSTGRYSRPMVYDKLKNMEIPEVKKVSPEEEKREEKKREETMKSIYGEEHIKDNK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcgcttttcaatgttagtttgtgtatcttttattttcttcactggtgggtgt
gctgaaagtagtgcgaattcaaatgatggttctaaaaataaaaatgagtctaaagaggaa
tcctccgaagaaggtgtaaaggaaaatgataataaactcgcggatactccaaatatggat
gattgtattgaagtgtacggaaaagaagagtgtgaacagatcactgagtactataaaagt
gaagaagggcaaaaggagttggatgcaagcgaaacagataaatattctgcaaagtctcaa
acaagtactacacataaagatatctatgaaaaagtatcctggcttgttaaagaaatgttc
ggagtaccagaaagaacaattccagctgattatgaaaaaagtttggtagaaaaaagggat
gatggtttatattacattcaatcttcttatgaaataaaaggaactggaaaccaagcggat
acttactatgagtttgaaatgttgatggataataaatacaacttgatagacgcatatttt
cccggcagcacaggaagatattcacgccctatggtgtatgacaaacttaaaaacatggaa
ataccagaagtaaagaaagtatctccagaggaagagaaaagggaagagaaaaaacgtgaa
gaaacaatgaagagtatttatggggaagagcatataaaggacaataaataa

DBGET integrated database retrieval system