KEGG   Bacillus subtilis subsp. subtilis 168: BSU21660Help
Entry
BSU21660          CDS       T00010                                 

Gene name
yokA
Definition
(RefSeq) resolvase YokA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Recombinase Resolvase Zn_ribbon_recom DUF5106
Motif
Other DBs
NCBI-GeneID: 939105
NCBI-ProteinID: NP_390049
Pasteur: BG13568
BSORF: BG13568
UniProt: O32006
Position
2284771..2286408
Genome map
AA seq 545 aa AA seqDB search
MELKNIVNSYNITNILGYLRRSRQDMEREKRTGEDTLTEQKELMNKILTAIEIPYELKME
IGSGESIDGRPVFKECLKDLEEGKYQAIAVKEITRLSRGSYSDAGQIVNLLQSKRLIIIT
PYKVYDPRNPVDMRQIRFELFMAREEFEMTRERMTGAKYTYAAQGKWISGLAPYGYQLNK
KTSKLDPVEDEAKVVQLIFNIFLNGLNGKDYSYTAIASHLTNLQIPTPSGKKRWNQYTIK
AILQNEVYIGTVKYKVREKTKDGKRTIRPEKEQIVVQDAHAPIIDKEQFQQSQVKIANKV
PLLPNKDEFELSELAGVCTCSKCGEPLSKYESKRIRKNKDGTESVYHVKSLTCKKNKCTY
VRYNDVENAILDYLSSLNDLNDSTLTKHINSMLSKYEDDNSNMKTKKQMSEHLSQKEKEL
KNKENFIFDKYESGIYSDELFLKRKAALDEEFKELQNAKNELNGLQDTQSEIDSNTVRNN
INKIIDQYHIESSSEKKNELLRMVLKDVIVNMTQKRKGPIPAQFEITPILRFNFIFDLTA
TNSFH
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
ttggagttaaaaaacattgttaattcttacaacatcacaaatattttagggtatcttaga
cgttctcgtcaggacatggaacgagaaaaaagaacaggtgaagacacactcacagaacaa
aaagaacttatgaataaaatacttacggccattgagatcccttatgaattaaaaatggag
attggatcaggagaaagcattgatggtcgacctgttttcaaagaatgtcttaaagatctt
gaggaaggcaaatatcaggcaattgctgttaaagaaataacaagacttagtcgtgggagt
tatagcgatgcaggacaaattgttaacctccttcaaagcaaacgattgatcataattaca
ccatataaggtttatgaccctagaaaccctgttgacatgcgccagatacgttttgagtta
tttatggctagagaagaatttgaaatgactagggagcgtatgacaggcgctaaatacact
tatgcagcacagggaaaatggatatctggactggcaccttatggataccaattaaacaaa
aagacgtctaaactagatccagttgaggatgaagcaaaagtagttcaattaatttttaac
atctttctaaatgggttgaatggaaaagattatagctatacagcaattgcttcacatcta
acaaatttacaaatccctacaccgtcagggaaaaaacgttggaatcaatacacaatcaaa
gcaattctccaaaatgaagtttatataggaactgttaaatataaggttagagaaaaaaca
aaagacggaaagagaacaattagacctgaaaaagaacaaattgtagtacaagatgcgcat
gctcctataattgacaaagaacaatttcaacaatcacaagtaaaaatcgcaaacaaagtt
ccccttttgccaaataaagatgaatttgaattaagtgaactggccggtgtttgtacttgc
tcaaaatgtggtgagcctttatctaaatacgaatctaaacgcatacgaaaaaacaaagat
ggaactgaaagcgtttatcacgttaaatcgctcacatgtaagaaaaataagtgtacgtat
gtgagatataacgatgttgaaaatgcaattctggattacctctcttccttaaatgactta
aatgatagtactttaacaaaacacatcaattcgatgctttcaaagtacgaagacgacaac
agtaacatgaaaacaaaaaagcaaatgtctgaacacctttcacaaaaagagaaagagcta
aaaaacaaagagaacttcatcttcgataaatatgaaagtggcatttacagtgatgaactt
tttttgaagagaaaagctgcattagatgaagaatttaaagagctccagaatgcaaagaat
gagctcaatggattacaagatacacaatcagaaatagacagtaatacagtgagaaacaac
ataaataaaataattgaccagtatcacattgaatcaagctcagagaaaaagaacgagcta
ttaaggatggtcttaaaagatgttattgttaacatgacacaaaaaagaaaagggcctata
ccagctcaatttgaaataacccctatcctaaggtttaatttcatttttgacctcacagcc
actaatagtttccactaa

DBGET integrated database retrieval system