KEGG   Bacillus subtilis subsp. subtilis 168: BSU21680Help
Entry
BSU21680          CDS       T00010                                 

Gene name
yppQ
Definition
(RefSeq) peptide methionine sulfoxide reductase MsrB
  KO
K07305  peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU21680 (yppQ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     BSU21680 (yppQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SelR
Motif
Other DBs
NCBI-GeneID: 939102
NCBI-ProteinID: NP_390051
Pasteur: BG11628
BSORF: BG11628
UniProt: P54155
Structure
PDB: 

Position
complement(2287097..2287528)
Genome map
AA seq 143 aa AA seqDB search
MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDS
QCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLGHVFNDGPGPNGLRYCINSAA
LRFVPKHKLKEEGYESYLHLFNK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacaataaagaagaaaaaataaagtcattaaatcgcatgcaatatgaagtaacg
caaaataacggcacggagccgccatttcaaaatgaatattgggatcataaggaagaaggg
ttgtatgtagacattgtgtcaggcaagccattgtttacatccaaagataaatttgattcc
caatgcggctggccaagctttacaaagccgattgaagaagaagtggaagaaaaactggac
acgagccacggcatgattcgcacagaagtaagaagccgaactgctgattctcatcttggc
cacgtatttaatgacggaccggggccaaacggacttcgttactgcataaattcagcagcg
ctgcggtttgttccgaagcataagctaaaagaagaaggatacgaaagctatctgcatctc
tttaataaataa

DBGET integrated database retrieval system