KEGG   Bacillus subtilis subsp. subtilis 168: BSU21690Help
Entry
BSU21690          CDS       T00010                                 

Gene name
msrA
Definition
(RefSeq) peptide methionine sulfoxide reductase MsrA
  KO
K07304  peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU21690 (msrA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     BSU21690 (msrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMSR
Motif
Other DBs
NCBI-GeneID: 939099
NCBI-ProteinID: NP_390052
Pasteur: BG11627
BSORF: BG11627
UniProt: P54154
Position
complement(2287529..2288062)
Genome map
AA seq 177 aa AA seqDB search
MSEKKEIATFAGGCFWCMVKPFDEQPGIEKVVSGYTGGHTENPTYEEVCSETTGHREAVQ
ITFHPDVFPYEKLLELFWQQIDPTDAGGQFADRGSSYRAAIFYHNDKQKELAEASKQRLA
ESGIFKDPIVTDILKAEPFYEAEGYHQHFYKKNPAHYQRYRTGSGRAGFISEHWGAK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaaaaagaaatcgccacatttgcaggaggctgtttttggtgtatggttaaa
ccttttgacgaacagccgggaattgaaaaagtggtgtccgggtatacaggcggccatact
gaaaaccctacgtacgaagaggtgtgcagtgaaacgacgggacatcgtgaagccgttcaa
atcacgtttcatcctgatgtattcccttatgaaaaactgcttgaattattttggcagcaa
atcgatccgacagatgccggagggcaatttgctgatcgcggcagttcctatcgcgcagcc
attttttatcataatgataaacaaaaggagcttgcggaagcttccaagcaacgtctggcg
gaaagcggcatctttaaagatccgattgtaacggacattttaaaagctgaacctttctat
gaagcggaaggctaccatcagcatttttataaaaagaatccagcacattatcagcgctac
cggacaggttccggacgagcgggatttatcagcgagcattggggggctaaataa

DBGET integrated database retrieval system