KEGG   Bacillus subtilis subsp. subtilis 168: BSU21700
Entry
BSU21700          CDS       T00010                                 

Gene name
ypoP
Definition
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR HTH_27 MarR_2 TrmB EF-G-binding_N HTH_34 DUF4364 DctP HTH_5 FNIP_M Penicillinase_R
Other DBs
NCBI-GeneID: 939103
NCBI-ProteinID: NP_390053
Pasteur: BG11626
BSORF: BG11626
UniProt: P54182 A0A6M4JN61
Position
2288194..2288619
AA seq 141 aa
MKVRTQMMYDMETLLRKVFKQIRNEINEILDKELSRNEFTILRILSEQGPKKVTEFAPIL
EVSASHITAVTDALVEKEWITRIRSKEDRRIIRIHITEAGEKVLQHFNEKKTEYFFKRFD
CYTDAELATLIELFSKLDKKR
NT seq 426 nt   +upstreamnt  +downstreamnt
ttgaaagtaagaacacagatgatgtacgatatggaaactttactccgtaaagtctttaaa
caaatacgcaatgaaatcaatgaaattttagataaagagctgtcgcggaatgaattcacc
attcttcgaatccttagtgaacaagggcctaaaaaagtcactgaatttgcgcctatttta
gaggtatcggcaagccacattacggctgtgaccgatgcgctggtagaaaaggaatggatt
acgagaatcagatcgaaggaagacagacgcatcatccgcattcatatcactgaagcgggc
gaaaaagtccttcagcactttaacgagaaaaaaacggaatatttctttaaacgctttgac
tgctacactgatgctgaacttgccacgttaatcgagctcttcagcaaacttgataaaaaa
cggtga

DBGET integrated database retrieval system