KEGG   Bacillus subtilis subsp. subtilis 168: BSU21720
Entry
BSU21720          CDS       T00010                                 

Gene name
ypmT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YpmT DUF3953 DUF3179
Other DBs
NCBI-GeneID: 939101
NCBI-ProteinID: NP_390055
Pasteur: BG11624
BSORF: BG11624
UniProt: P54180 A0A6M3ZIE3
Position
complement(2290078..2290272)
AA seq 64 aa
MKRIYQYFSLLSFTFSLYFGWLAYHHLAAEDMDQMYLNVSYCALFLSVMVFTFGMRDRKK
TDKS
NT seq 195 nt   +upstreamnt  +downstreamnt
atgaaacggatttaccagtatttcagtttattatcctttacattttccctgtacttcggc
tggcttgcttatcatcatctggctgctgaagatatggatcaaatgtatttgaatgtttcc
tattgtgccttgttcctaagtgtgatggtgtttacattcggtatgcgagaccgaaaaaaa
accgataagtcatga

DBGET integrated database retrieval system