KEGG   Bacillus subtilis subsp. subtilis 168: BSU21730Help
Entry
BSU21730          CDS       T00010                                 

Gene name
ypmS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2140
Motif
Other DBs
NCBI-GeneID: 939100
NCBI-ProteinID: NP_390056
Pasteur: BG11623
BSORF: BG11623
UniProt: P54179
Position
complement(2290285..2290848)
Genome map
AA seq 187 aa AA seqDB search
MNKWKRLFFILLAINFILAAGFVALVLLPGEQAQVKDASESEYGFQVTSTKESLAAFVNS
YLNDKASNKLDYKVEIDDDVHVAGKIKAFSTSIDAFIAFEPTVKKNGDVELNVTKFSLGK
LSIPISFVLNYMDSFYELPSFVHVHPGDKSIEVRLSEMPLTNGMYVKADKINLEKDEIEF
SYYHPKQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtggaagcgactgttttttatattgcttgcaatcaattttatcctcgccgcc
gggtttgtggcacttgttttgcttccgggggaacaggctcaggtgaaagatgcatctgag
agcgagtatggatttcaagtgacaagcacaaaagaatcattagctgcgtttgttaactca
tatttaaacgacaaagcatcaaacaagcttgattataaagtagagattgatgatgatgtt
catgtcgcagggaaaatcaaggcattttccacgtctattgatgcgtttatcgcttttgag
ccgaccgtgaaaaaaaacggtgatgtagagctgaatgtcacgaaattttcgttagggaaa
ttgagtataccaattagctttgtgttaaattatatggacagcttttatgaattgccgtca
tttgtccatgttcaccccggagataaaagcattgaagtgcgtttgtcagaaatgccttta
acgaatggaatgtatgtcaaagcggataagataaatttagaaaaagatgaaattgagttt
tcctattaccatcctaaacaatag

DBGET integrated database retrieval system