KEGG   Bacillus subtilis subsp. subtilis 168: BSU21740Help
Entry
BSU21740          CDS       T00010                                 

Gene name
ypmR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL
Motif
Other DBs
NCBI-GeneID: 939097
NCBI-ProteinID: NP_390057
Pasteur: BG11022
BSORF: BG11022
UniProt: P40766
Position
complement(2290858..2291625)
Genome map
AA seq 255 aa AA seqDB search
MKLRIFSIMASLILLLTACTSIRTSSEGKQKAHETKTKEHIVIAAVGDSLTEGVGDPDGK
GYVGKVADSIRSDKQVKTVDVKNYAVKGNRSDDLLEKLKDKKVQKGIKDADYVFFTIGGN
DLMKILRQNFLQLTVEPFQEAEKPYEKRFEKIISEIRELNDHAELIYVSMYNPFTFTLSE
LNEINGVVTDWNHIAEKELKKDKHAKIVHIEDLFNQKSDSSRISEEDDFHPNGTGYSLIA
KRVYQAIKKEGLPKE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctgcgcattttttcaatcatggccagtttgattttgcttcttactgcgtgtacg
agcatacgtacatcatctgagggaaaacaaaaagcccatgaaacgaaaacaaaagaacac
attgtcatagcggctgtcggagattcgctgacagaaggagtcggagatcccgacggaaag
ggatatgtcggcaaggtggcggattctatccggtcagataaacaagtcaaaacggtcgac
gtgaaaaattatgctgtaaaagggaaccgttcggatgatttattagaaaaactaaaagat
aaaaaggttcaaaaaggcataaaggacgcagattatgtcttttttacaattggcggtaat
gatttgatgaaaatccttcgccaaaactttctgcaattaaccgttgaaccgtttcaggaa
gcggaaaaaccgtacgaaaagcgctttgaaaaaatcatttctgaaattcgcgagctgaat
gatcacgctgagctgatttatgtcagcatgtacaatccgtttacgtttacattatcagaa
ctaaatgaaataaatggtgtcgtcacggattggaaccatattgctgaaaaagagctgaaa
aaagataaacatgcaaaaatcgtccatatcgaagatttgtttaatcaaaaaagtgacagc
agccgaatttctgaggaagatgattttcatcctaatggtacgggttattctcttatcgca
aagcgcgtctatcaagccattaaaaaagaaggattaccgaaagagtag

DBGET integrated database retrieval system