KEGG   Bacillus subtilis subsp. subtilis 168: BSU21750Help
Entry
BSU21750          CDS       T00010                                 

Gene name
scuA
Definition
(RefSeq) SCO1 protein
  KO
K07152  protein SCO1/2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU21750 (scuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SCO1-SenC AhpC-TSA Redoxin Thioredoxin_8 GSHPx
Motif
Other DBs
NCBI-GeneID: 939098
NCBI-ProteinID: NP_390058
Pasteur: BG11622
BSORF: BG11622
UniProt: P54178
Structure
PDB: 

Position
complement(2291703..2292284)
Genome map
AA seq 193 aa AA seqDB search
MKVIKGLTAGLIFLFLCACGGQQIKDPLNYEVEPFTFQNQDGKNVSLESLKGEVWLADFI
FTNCETICPPMTAHMTDLQKKLKAENIDVRIISFSVDPENDKPKQLKKFAANYPLSFDNW
DFLTGYSQSEIEEFALKSFKAIVKKPEGEDQVIHQSSFYLVGPDGKVLKDYNGVENTPYD
DIISDVKSASTLK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttatcaaggggttaacggctgggctgatttttctgtttttgtgtgcatgcgga
ggacagcagattaaagatccgctcaattacgaggtggagccttttacatttcaaaaccaa
gacggcaagaacgtttctttagagagtttaaaaggagaagtatggctggcggattttatt
tttaccaattgtgaaactatatgtccgccaatgaccgctcatatgaccgatctgcaaaaa
aaactgaaagccgaaaatatagatgtccgcatcatatcatttagtgttgatccagaaaac
gataagccgaaacagctgaagaaatttgccgcaaattatccattatcttttgataactgg
gattttctcacgggatacagccagagtgagattgaggagttcgcacttaagagctttaaa
gcgatcgtaaagaagccggagggagaggaccaagtgattcatcaatcttctttttatttg
gtaggtccggacggtaaggtgctgaaagattacaatggagtggagaatacaccgtacgat
gatatcatttccgatgtgaagtcagccagtacactcaagtaa

DBGET integrated database retrieval system