KEGG   Bacillus subtilis subsp. subtilis 168: BSU21750
Entry
BSU21750          CDS       T00010                                 

Symbol
scuA
Name
(RefSeq) SCO1 protein
  KO
K07152  protein SCO1
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU21750 (scuA)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU21750 (scuA)
SSDB
Motif
Pfam: SCO1-SenC AhpC-TSA Redoxin Thioredoxin_8 GSHPx
Other DBs
NCBI-GeneID: 939098
NCBI-ProteinID: NP_390058
Pasteur: BG11622
BSORF: BG11622
UniProt: P54178 A0A6M3ZD20
Structure
Position
complement(2291703..2292284)
AA seq 193 aa
MKVIKGLTAGLIFLFLCACGGQQIKDPLNYEVEPFTFQNQDGKNVSLESLKGEVWLADFI
FTNCETICPPMTAHMTDLQKKLKAENIDVRIISFSVDPENDKPKQLKKFAANYPLSFDNW
DFLTGYSQSEIEEFALKSFKAIVKKPEGEDQVIHQSSFYLVGPDGKVLKDYNGVENTPYD
DIISDVKSASTLK
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaaggttatcaaggggttaacggctgggctgatttttctgtttttgtgtgcatgcgga
ggacagcagattaaagatccgctcaattacgaggtggagccttttacatttcaaaaccaa
gacggcaagaacgtttctttagagagtttaaaaggagaagtatggctggcggattttatt
tttaccaattgtgaaactatatgtccgccaatgaccgctcatatgaccgatctgcaaaaa
aaactgaaagccgaaaatatagatgtccgcatcatatcatttagtgttgatccagaaaac
gataagccgaaacagctgaagaaatttgccgcaaattatccattatcttttgataactgg
gattttctcacgggatacagccagagtgagattgaggagttcgcacttaagagctttaaa
gcgatcgtaaagaagccggagggagaggaccaagtgattcatcaatcttctttttatttg
gtaggtccggacggtaaggtgctgaaagattacaatggagtggagaatacaccgtacgat
gatatcatttccgatgtgaagtcagccagtacactcaagtaa

DBGET integrated database retrieval system