KEGG   Bacillus subtilis subsp. subtilis 168: BSU21760Help
Entry
BSU21760          CDS       T00010                                 

Gene name
ypmP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2535
Motif
Other DBs
NCBI-GeneID: 939096
NCBI-ProteinID: NP_390059
Pasteur: BG11621
BSORF: BG11621
UniProt: P54177
Position
complement(2292432..2292683)
Genome map
AA seq 83 aa AA seqDB search
MLLKSLEFKRGDGIQVKVTEIPVLKEDEHYFFMLHHHLQFYLKEVFSSNSRAKVYSFRHY
MKRRMKWADYQAVFHQEVLKHNA
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
ttgttactcaaaagcctagagttcaaacgcggtgacgggattcaggtgaaagtgacagaa
atacctgtattaaaggaagatgagcactatttctttatgttacatcaccatttgcaattc
tacttaaaagaagtgttttcatcaaacagcagggcaaaagtgtattctttccgacattat
atgaagcggcggatgaagtgggcagattatcaggctgtatttcatcaagaggtgttaaag
cacaacgcgtaa

DBGET integrated database retrieval system