KEGG   Bacillus subtilis subsp. subtilis 168: BSU21770Help
Entry
BSU21770          CDS       T00010                                 

Gene name
ilvA
Definition
(RefSeq) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU21770 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    BSU21770 (ilvA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     BSU21770 (ilvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_dehydrat_C
Motif
Other DBs
NCBI-GeneID: 939093
NCBI-ProteinID: NP_390060
Pasteur: BG10673
BSORF: BG10673
UniProt: P37946
Position
complement(2292769..2294037)
Genome map
AA seq 422 aa AA seqDB search
MKPLLKENSLIQVKDILKAHQNVKDVVIHTPLQRNDRLSERYECNIYLKREDLQVVRSFK
LRGAYHKMKQLSSEQTENGVVCASAGNHAQGVAFSCKHLGIHGKIFMPSTTPRQKVSQVE
LFGKGFIDIILTGDTFDDAYKSAAECCEAESRTFIHPFDDPDVMAGQGTLAVEILNDIDT
EPHFLFASVGGGGLLSGVGTYLKNVSPDTKVIAVEPAGAASYFESNKAGHVVTLDKIDKF
VDGAAVKKIGEETFRTLETVVDDILLVPEGKVCTSILELYNECAVVAEPAGALSVAALDL
YKDQIKGKNVVCVVSGGNNDIGRMQEMKERSLIFEGLQHYFIVNFPQRAGALREFLDEVL
GPNDDITRFEYTKKNNKSNGPALVGIELQNKADYGPLIERMNKKPFHYVEVNKDEDLFHL
LI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgttgcttaaagaaaactctctcatccaagtgaaagacattttgaaggctcac
caaaacgtaaaggacgttgtcattcacacacctttgcagaggaatgacagactttctgag
agatatgaatgcaatatctatttaaaacgcgaagacttgcaagttgtcagatcttttaag
ctcagaggggcttatcataaaatgaaacagctttccagcgagcagacagagaacggagtt
gtgtgtgcaagtgccggaaaccacgctcaaggtgtggcattttcgtgtaaacatcttggc
attcacgggaaaatttttatgccgtctactacaccgagacaaaaagtatctcaagttgaa
ctattcggaaaaggatttatcgatattattttgacaggcgatacgtttgacgacgcgtat
aaaagcgctgctgaatgctgtgaggcggaatctcggacgtttatccatccgttcgatgat
ccggatgtgatggccggacagggaacgctcgcagtcgagattttaaacgacattgataca
gaaccgcattttctttttgcaagtgtcggaggcggcggccttctctctggggtaggtaca
tatttgaaaaacgtgtctcctgatacaaaggtaattgctgttgagccggcgggagcggca
tcctactttgaatcaaacaaagctgggcatgtcgtcacacttgataaaattgataagttt
gtagatggggcggctgttaaaaaaattggcgaggaaaccttccggacgctggaaactgtc
gttgatgacattctccttgtgcctgaaggaaaagtatgtacatccattcttgaattatat
aacgaatgtgcggttgttgctgaaccggctggagctctttctgtcgcagcgcttgatttg
tacaaggatcaaattaaagggaaaaacgtggtgtgtgtggtaagcgggggcaataacgat
atcggaagaatgcaggaaatgaaggagcgttccttgatttttgaaggccttcagcattat
tttatcgtcaattttccacaaagagcgggggcgctccgcgaatttcttgacgaagtcctc
gggccgaatgatgacattacaaggtttgaatatacgaagaaaaataataaaagcaatgga
cctgctcttgtcggcatcgagctgcagaacaaagccgattatgggccgctgattgaacgg
atgaacaaaaaaccgtttcattatgtagaggtgaacaaggatgaggacttgttccatttg
ctaatctaa

DBGET integrated database retrieval system