KEGG   Bacillus subtilis subsp. subtilis 168: BSU21790Help
Entry
BSU21790          CDS       T00010                                 

Gene name
yplQ
Definition
(RefSeq) hemolysin-3
  KO
K11068  hemolysin III
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bsu02042]
    BSU21790 (yplQ)
Bacterial toxins [BR:bsu02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   BSU21790 (yplQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyIII
Motif
Other DBs
NCBI-GeneID: 939095
NCBI-ProteinID: NP_390062
Pasteur: BG11620
BSORF: BG11620
UniProt: P54175
Position
2295302..2295943
Genome map
AA seq 213 aa AA seqDB search
MFTIKEEIANAITHGIGVLLSIPALVFLIIFAANYGSAWDIVSFTIFGVSMLLLYLSSTL
LHSITHKKTKDILEIIDHSAIYVLIAGTYTPFLLGPLKGTLGFTLLVIVWSLALGGIVFK
IFFVKRFILLSTFVYLVMGWLMIIAVKPLYASLSGAGFSLLFLGGILYSVGTIFYIWKKI
PFHHAIWHSFVLGGSAAMFFCVLFYCVKVPFLS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgtttacaatcaaagaagagatcgccaatgcgattacacacggcatcggtgtcctctta
tccatcccagcattagtgtttctaatcatatttgcggctaattacgggtctgcatgggac
attgtcagctttacaatattcggtgtctctatgctgctgttatatttgagctccaccctg
cttcacagcatcacacataaaaaaacgaaggacattttggagattattgatcatagcgca
atttacgtactcatcgccggaacctacacgccttttttgcttgggccgctgaaaggcaca
ctcggctttaccctgttggttatcgtatggtcacttgccctaggcggaatcgtttttaaa
attttctttgtgaaacggtttatcctattgtcaaccttcgtgtatttagtcatggggtgg
ctgatgattattgcagttaaacctttatatgcttcactgagcggagcgggattcagcctc
ctttttctcggcggcattttatactctgtcggaaccatcttttacatttggaaaaagatc
cccttccatcacgccatttggcacagctttgtattgggcgggagcgctgccatgtttttc
tgcgtgctcttctattgtgtaaaggtgcctttcctttcgtaa

DBGET integrated database retrieval system