KEGG   Bacillus subtilis subsp. subtilis 168: BSU21800
Entry
BSU21800          CDS       T00010                                 

Gene name
ypkP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939090
NCBI-ProteinID: NP_390063
Pasteur: BG11618
BSORF: BG11618
UniProt: P54174 A0A6M3ZD18
Position
complement(2295982..2296602)
AA seq 206 aa
MVRYSLLVVYIVYMLLKNMKQLFNQTMLDPRLSYKKQMALVYEQPKAFLEGCIGISGSVV
TIHQPEPIPHGPVLYVHPRLRLAELALIAGYIEEPAGFIANPKVFRLPFIGQWLDRMDVI
SDGDSEKVYEDVTKQLEKGQSLILSLDGSIDPVELAARYHLPLVMVETKGTDNMQNGSFF
KRLKPADIELSFSKAYIPANEKQLRA
NT seq 621 nt   +upstreamnt  +downstreamnt
ttggttcgctacagccttctagtggtttatattgtgtatatgctgttaaaaaatatgaaa
caattatttaatcaaacaatgctcgatccccgtctgtcatacaaaaaacagatggctctt
gtgtacgaacagccaaaggcgtttttagaaggctgtatcggcatctccggttcagttgtg
acgatccatcagccagagccaataccacacggtcctgttttgtatgtgcatccccgtttg
cgtttggctgaactggccttaattgctggatatattgaggaaccggccggctttatcgct
aacccaaaagtgttccgcttgccttttatcgggcaatggctggatcggatggatgtgatt
tcagacggggattcagaaaaggtatatgaagatgtgacaaaacagctggaaaagggacaa
agcctgattctttcactagatggttctattgatcctgtagaacttgcggcccgctatcat
cttccgttggtgatggtggaaacgaaaggaacagataacatgcaaaatggctcgtttttt
aaacgcttaaaaccggcagacattgaattgtccttttcaaaagcttatatacctgccaat
gaaaaacaattacgtgcataa

DBGET integrated database retrieval system