KEGG   Bacillus subtilis subsp. subtilis 168: BSU21820Help
Entry
BSU21820          CDS       T00010                                 

Gene name
thyA
Definition
(RefSeq) thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu00670  One carbon pool by folate
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU21820 (thyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU21820 (thyA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     BSU21820 (thyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylat_synt
Motif
Other DBs
NCBI-GeneID: 939092
NCBI-ProteinID: NP_390065
Pasteur: BG10794
BSORF: BG10794
UniProt: P11044
Position
complement(2297106..2297900)
Genome map
AA seq 264 aa AA seqDB search
MKQYKDFCRHVLEHGEKKGDRTGTGTISTFGYQMRFNLREGFPMLTTKKLHFKSIAHELL
WFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSWRGADGETIDQISRLIEDIK
TNPNSRRLIVSAWNVGEIDKMALPPCHCLFQFYVSDGKLSCQLYQRSADVFLGVPFNIAS
YALLTMIIAHVTGLEPGEFIHTFGDVHIYQNHIEQVNLQLERDVRPLPQLRFARKVDSIF
NFAFEDFIIEDYDPHPHIKGAVSV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtataaggatttctgcagacatgttttagagcatggtgagaaaaagggagac
cggactgggaccggaacaatcagcactttcggatatcaaatgagatttaatttacgggaa
ggctttccgatgctcaccactaaaaaactccactttaaatcaattgcgcatgaactgctg
tggttcttaaaaggagatacgaatgtacgctatctgcaggaaaacggagtgcgaatctgg
aatgagtgggctgatgaaaacggtgaacttggacctgtatatggctcccaatggcgttct
tggcggggagctgatggagaaaccattgatcaaatttcccgtcttattgaagatattaaa
acaaatccgaactccagacgcttaatcgtcagcgcctggaatgttggtgaaattgataaa
atggcgttgccgccgtgccattgcctgttccaattctatgtgtctgacggcaagctgtcc
tgtcagctgtatcagcgctctgccgatgttttcttaggtgtgccgtttaatattgcatct
tatgccctcctaaccatgatcattgctcatgtgactgggcttgaaccgggcgagttcatc
catacgtttggtgatgttcatatttaccaaaatcatattgaacaagtcaatttgcagctg
gaaagagatgttagaccgcttccgcagcttcgtttcgccagaaaggttgattctattttt
aactttgcatttgaggactttatcatcgaggattatgatccgcatcctcatataaaaggg
gcggtcagcgtatga

DBGET integrated database retrieval system