KEGG   Bacillus subtilis subsp. subtilis 168: BSU21830Help
Entry
BSU21830          CDS       T00010                                 

Gene name
ypjQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PgpA DNA_methylase DUF1411 DUF4355
Motif
Other DBs
NCBI-GeneID: 939087
NCBI-ProteinID: NP_390066
Pasteur: BG11617
BSORF: BG11617
UniProt: P54173
Structure
PDB: 

Position
complement(2297984..2298517)
Genome map
AA seq 177 aa AA seqDB search
MKKYTMNEMVDITKDMLNKRGVMIEDIARIVQKLQEKYNPNLPLSVCMENVEKVLNKREI
IHAVLTGLALDQLAEQKLLPEPLQHLVETDEPLYGIDEIIPLSIVNVYGSIGLTNFGYLD
KEKIGIIKELDESPDGIHTFLDDIVAALAAAAASRIAHTHQDLQDEEKEQDEKPVVS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtacacaatgaatgaaatggtcgatataacaaaggatatgctgaacaaacgg
ggcgttatgatagaagatattgcacggattgttcaaaaacttcaggaaaaatacaatcca
aatctgccgctcagtgtttgcatggagaatgtagaaaaagtcctgaacaaacgtgaaatt
attcatgctgttttgacaggccttgcactcgatcagcttgcagaacagaaacttctcccc
gaaccgctgcagcaccttgttgaaacggatgaaccgctttacggcatagatgaaattatc
ccgctttcaatcgttaatgtgtacgggtcgatcggtttgaccaatttcggttatttggat
aaagagaagattggaattattaaggaacttgatgaaagtccagacggtattcacaccttt
ttggatgatattgtggcagctcttgctgcagcagcggcgagcagaattgcacatacgcat
caggatctgcaagatgaagaaaaagaacaggatgaaaagcctgtcgtcagctga

DBGET integrated database retrieval system