KEGG   Bacillus subtilis subsp. subtilis 168: BSU21840Help
Entry
BSU21840          CDS       T00010                                 

Gene name
ypjP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YpjP
Motif
Other DBs
NCBI-GeneID: 939089
NCBI-ProteinID: NP_390067
Pasteur: BG11616
BSORF: BG11616
UniProt: P54172
Position
complement(2298535..2299146)
Genome map
AA seq 203 aa AA seqDB search
MKLWMRKTLVVLFTIVTFGLVSPPAALMADKPSGQPSSLEQNDYTAFYDEHDLYDDESDD
RRDPELLFQSYKEQLLDSAEDQSFLKFGSRIAPVIEDDYRKEILPKIENVISDYLATLQD
DEAYQDVVISSMPSAGKTEKIFNVYNRTTGEDLLRFHVRRDHPPHDGYWFNFHYHTAEDG
FQSHHELGSIYWDRNTPPNWMSA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtggatgagaaagacccttgtggttttatttaccattgtaacgttcgggctc
gtatctcctccggctgcccttatggcggacaagccttccggacagccgagcagtcttgag
cagaatgattacaccgctttttatgatgagcatgacctgtacgatgatgagtcggatgac
aggcgagatcctgaactgctttttcaatcgtacaaggaacagctccttgacagcgctgag
gatcagtcctttttaaaattcggcagcagaatcgctcctgtcattgaggatgactatcgg
aaagagatcctgccaaaaatcgaaaatgtgattagtgattatttagcgacattgcaagat
gatgaggcgtaccaagatgttgtgatctcaagcatgccttcagcgggcaaaacggaaaaa
attttcaacgtttacaatcggacaactggagaagatcttctcagattccatgtgcgaaga
gaccacccgcctcatgacggctactggtttaattttcattatcatacagcagaagatgga
tttcaatcacatcatgagcttgggagcatttactgggaccgcaacacgcctcccaactgg
atgagtgcctaa

DBGET integrated database retrieval system