KEGG   Bacillus subtilis subsp. subtilis 168: BSU21850
Entry
BSU21850          CDS       T00010                                 

Gene name
ypiP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SAM_MT PCMT Methyltransf_11 Cons_hypoth95
Other DBs
NCBI-GeneID: 939088
NCBI-ProteinID: NP_390068
Pasteur: BG11615
BSORF: BG11615
UniProt: P54171 A0A6M4JKI6
Position
complement(2299406..2300179)
AA seq 257 aa
MITTSYRPSEHTIKTAKQLSKELNMPYCGRNKQTVEHLLKSAERDLLVVGKERFELYTKQ
GAKFFFHPNTAMFRAKRFLQGEKEPMLRAAGLSEGDTFLDCTLGLGSDAIIASMAVGETG
SVVGIEKNHLVSVLVRTGLHSWETGIEELQAAMRRIQVKNGDCFEHIKQLPDNSVDVVYF
DPMFHEPVETSDGIAPLRDLAEDSVLHEGCINEAVRVARKSVVLKDHWKSPRFEQFGFNV
MKRKTALFHYGVIQTSP
NT seq 774 nt   +upstreamnt  +downstreamnt
atgataacaacaagctatagaccgtctgaacacaccataaaaactgcaaagcagctttct
aaagagctaaatatgccatactgcggccggaataaacaaacggttgagcacctgctgaaa
tcagctgaacgtgatttgcttgtggtcggcaaagagcggtttgagctgtatacgaaacaa
ggtgccaaattcttttttcatccgaatacagcgatgttcagagccaaacgcttcttacag
ggggagaaagaacctatgcttcgggctgccggcttatctgaaggggatacgtttttagat
tgcacactcgggttggggtcagatgccattatcgcaagtatggcagtaggcgaaacgggt
tctgttgttgggattgaaaaaaaccatcttgtgtctgttttagtgaggacggggctgcat
tcatgggaaacgggtatagaagagcttcaagctgcgatgagaagaatccaggtgaagaat
ggtgattgctttgaacacatcaagcagctccctgacaactctgttgatgtggtttatttc
gatccaatgtttcatgaacctgtagaaacctctgacggcatcgcgcctttacgtgatttg
gcagaggattccgttttgcacgaaggatgtatcaatgaagcggtacgagtcgccagaaaa
agcgttgtgctaaaagaccactggaaaagcccgcggtttgaacagtttggttttaacgtc
atgaaaagaaaaacagcactgttccattatggcgtcattcaaacaagcccgtga

DBGET integrated database retrieval system