KEGG   Bacillus subtilis subsp. subtilis 168: BSU21860Help
Entry
BSU21860          CDS       T00010                                 

Gene name
yphP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Disulph_isomer ASRT LytR_C
Motif
Other DBs
NCBI-GeneID: 939085
NCBI-ProteinID: NP_390069
Pasteur: BG11614
BSORF: BG11614
UniProt: P54170
Structure
PDB: 

Position
complement(2300221..2300655)
Genome map
AA seq 144 aa AA seqDB search
MSMAYEEYMRQLVVPMRRELTGAGFEELTTAEEVENFMEKAEGTTLVVVNSVCGCAAGLA
RPAATQAVLQNDKTPDNTVTVFAGQDKEATAKMREYFTGQEPSSPSMALLKGKEVVHFIP
RHEIEGHDMEEIMKNLTAAFDAHC
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatggcttatgaagaatacatgcgccagcttgtcgtaccgatgcgccgcgagctg
actggagcaggttttgaagagttaacaacagcggaagaagtagaaaactttatggaaaag
gcagagggcacaactcttgtagtcgttaactctgtatgcggctgcgcggcaggccttgcg
cgtcctgcggctacacaggcagtcctccagaatgacaaaacacctgacaatacggtgact
gtatttgcgggccaagataaagaagctactgcgaaaatgcgtgagtattttactggccag
gagccttcttcaccatcaatggctcttttgaaaggcaaagaagtcgtacattttattccg
cgtcatgaaattgaaggacacgatatggaagaaatcatgaaaaatctgactgctgccttc
gatgcgcactgctaa

DBGET integrated database retrieval system