KEGG   Bacillus subtilis subsp. subtilis 168: BSU21870Help
Entry
BSU21870          CDS       T00010                                 

Gene name
ilvD
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU21870 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU21870 (ilvD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     BSU21870 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-GeneID: 939084
NCBI-ProteinID: NP_390070
Pasteur: BG11532
BSORF: BG11532
UniProt: P51785
Position
complement(2300762..2302438)
Genome map
AA seq 558 aa AA seqDB search
MAELRSNMITQGIDRAPHRSLLRAAGVKEEDFGKPFIAVCNSYIDIVPGHVHLQEFGKIV
KEAIREAGGVPFEFNTIGVDDGIAMGHIGMRYSLPSREIIADSVETVVSAHWFDGMVCIP
NCDKITPGMLMAAMRINIPTIFVSGGPMAAGRTSDGRKISLSSVFEGVGAYQAGKINENE
LQELEQFGCPTCGSCSGMFTANSMNCLSEALGLALPGNGTILATSPERKEFVRKSAAQLM
ETIRKDIKPRDIVTVKAIDNAFALDMALGGSTNTVLHTLALANEAGVEYSLERINEVAER
VPHLAKLAPASDVFIEDLHEAGGVSAALNELSKKEGALHLDALTVTGKTLGETIAGHEVK
DYDVIHPLDQPFTEKGGLAVLFGNLAPDGAIIKTGGVQNGITRHEGPAVVFDSQDEALDG
IINRKVKEGDVVIIRYEGPKGGPGMPEMLAPTSQIVGMGLGPKVALITDGRFSGASRGLS
IGHVSPEAAEGGPLAFVENGDHIIVDIEKRILDVQVPEEEWEKRKANWKGFEPKVKTGYL
ARYSKLVTSANTGGIMKI
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattacgcagtaatatgatcacacaaggaatcgatagagctccgcaccgcagt
ttgcttcgtgcagcaggggtaaaagaagaggatttcggcaagccgtttattgcggtgtgt
aattcatacattgatatcgttcccggtcatgttcacttgcaggagtttgggaaaatcgta
aaagaagcaatcagagaagcagggggcgttccgtttgaatttaataccattggggtagat
gatggcatcgcaatggggcatatcggtatgagatattcgctgccaagccgtgaaattatc
gcagactctgtggaaacggttgtatccgcacactggtttgacggaatggtctgtattccg
aactgcgacaaaatcacaccgggaatgcttatggcggcaatgcgcatcaacattccgacg
atttttgtcagcggcggaccgatggcggcaggaagaacaagtgacgggcgaaaaatctcc
ctttcctcagtattcgaaggggtaggcgcctaccaagcagggaaaatcaacgaaaacgag
cttcaagaactagagcagttcggatgcccaacgtgcgggtcttgctcaggcatgtttacg
gcgaactcaatgaactgtctgtcagaagcacttggtcttgctttgccgggtaatggaacc
attctggcaacatctccggaacgcaaagagtttgtgagaaaatcggctgcgcaattaatg
gaaacgattcgcaaagatatcaaaccgcgtgatattgttacagtaaaagcgattgataac
gcgtttgcactcgatatggcgctcggaggttctacaaataccgttcttcatacccttgcc
cttgcaaacgaagccggcgttgaatactctttagaacgcattaacgaagtcgctgagcgc
gtgccgcacttggctaagctggcgcctgcatcggatgtgtttattgaagatcttcacgaa
gcgggcggcgtttcagcggctctgaatgagctttcgaagaaagaaggagcgcttcattta
gatgcgctgactgttacaggaaaaactcttggagaaaccattgccggacatgaagtaaag
gattatgacgtcattcacccgctggatcaaccattcactgaaaagggaggccttgctgtt
ttattcggtaatctagctccggacggcgctatcattaaaacaggcggcgtacagaatggg
attacaagacacgaagggccggctgtcgtattcgattctcaggacgaggcgcttgacggc
attatcaaccgaaaagtaaaagaaggcgacgttgtcatcatcagatacgaagggccaaaa
ggcggacctggcatgccggaaatgctggcgccaacatcccaaatcgttggaatgggactc
gggccaaaagtggcattgattacggacggacgtttttccggagcctcccgtggcctctca
atcggccacgtatcacctgaggccgctgagggcgggccgcttgcctttgttgaaaacgga
gaccatattatcgttgatattgaaaaacgcatcttggatgtacaagtgccagaagaagag
tgggaaaaacgaaaagcgaactggaaaggttttgaaccgaaagtgaaaaccggctacctg
gcacgttattctaaacttgtgacaagtgccaacaccggcggtattatgaaaatctag

DBGET integrated database retrieval system