KEGG   Bacillus subtilis subsp. subtilis 168: BSU21870
Entry
BSU21870          CDS       T00010                                 

Gene name
ilvD
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU21870 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU21870 (ilvD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     BSU21870 (ilvD)
SSDB
Motif
Pfam: ILVD_EDD
Other DBs
NCBI-GeneID: 939084
NCBI-ProteinID: NP_390070
Pasteur: BG11532
BSORF: BG11532
UniProt: P51785 A0A6M3ZDB3
Position
complement(2300762..2302438)
AA seq 558 aa
MAELRSNMITQGIDRAPHRSLLRAAGVKEEDFGKPFIAVCNSYIDIVPGHVHLQEFGKIV
KEAIREAGGVPFEFNTIGVDDGIAMGHIGMRYSLPSREIIADSVETVVSAHWFDGMVCIP
NCDKITPGMLMAAMRINIPTIFVSGGPMAAGRTSDGRKISLSSVFEGVGAYQAGKINENE
LQELEQFGCPTCGSCSGMFTANSMNCLSEALGLALPGNGTILATSPERKEFVRKSAAQLM
ETIRKDIKPRDIVTVKAIDNAFALDMALGGSTNTVLHTLALANEAGVEYSLERINEVAER
VPHLAKLAPASDVFIEDLHEAGGVSAALNELSKKEGALHLDALTVTGKTLGETIAGHEVK
DYDVIHPLDQPFTEKGGLAVLFGNLAPDGAIIKTGGVQNGITRHEGPAVVFDSQDEALDG
IINRKVKEGDVVIIRYEGPKGGPGMPEMLAPTSQIVGMGLGPKVALITDGRFSGASRGLS
IGHVSPEAAEGGPLAFVENGDHIIVDIEKRILDVQVPEEEWEKRKANWKGFEPKVKTGYL
ARYSKLVTSANTGGIMKI
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggcagaattacgcagtaatatgatcacacaaggaatcgatagagctccgcaccgcagt
ttgcttcgtgcagcaggggtaaaagaagaggatttcggcaagccgtttattgcggtgtgt
aattcatacattgatatcgttcccggtcatgttcacttgcaggagtttgggaaaatcgta
aaagaagcaatcagagaagcagggggcgttccgtttgaatttaataccattggggtagat
gatggcatcgcaatggggcatatcggtatgagatattcgctgccaagccgtgaaattatc
gcagactctgtggaaacggttgtatccgcacactggtttgacggaatggtctgtattccg
aactgcgacaaaatcacaccgggaatgcttatggcggcaatgcgcatcaacattccgacg
atttttgtcagcggcggaccgatggcggcaggaagaacaagtgacgggcgaaaaatctcc
ctttcctcagtattcgaaggggtaggcgcctaccaagcagggaaaatcaacgaaaacgag
cttcaagaactagagcagttcggatgcccaacgtgcgggtcttgctcaggcatgtttacg
gcgaactcaatgaactgtctgtcagaagcacttggtcttgctttgccgggtaatggaacc
attctggcaacatctccggaacgcaaagagtttgtgagaaaatcggctgcgcaattaatg
gaaacgattcgcaaagatatcaaaccgcgtgatattgttacagtaaaagcgattgataac
gcgtttgcactcgatatggcgctcggaggttctacaaataccgttcttcatacccttgcc
cttgcaaacgaagccggcgttgaatactctttagaacgcattaacgaagtcgctgagcgc
gtgccgcacttggctaagctggcgcctgcatcggatgtgtttattgaagatcttcacgaa
gcgggcggcgtttcagcggctctgaatgagctttcgaagaaagaaggagcgcttcattta
gatgcgctgactgttacaggaaaaactcttggagaaaccattgccggacatgaagtaaag
gattatgacgtcattcacccgctggatcaaccattcactgaaaagggaggccttgctgtt
ttattcggtaatctagctccggacggcgctatcattaaaacaggcggcgtacagaatggg
attacaagacacgaagggccggctgtcgtattcgattctcaggacgaggcgcttgacggc
attatcaaccgaaaagtaaaagaaggcgacgttgtcatcatcagatacgaagggccaaaa
ggcggacctggcatgccggaaatgctggcgccaacatcccaaatcgttggaatgggactc
gggccaaaagtggcattgattacggacggacgtttttccggagcctcccgtggcctctca
atcggccacgtatcacctgaggccgctgagggcgggccgcttgcctttgttgaaaacgga
gaccatattatcgttgatattgaaaaacgcatcttggatgtacaagtgccagaagaagag
tgggaaaaacgaaaagcgaactggaaaggttttgaaccgaaagtgaaaaccggctacctg
gcacgttattctaaacttgtgacaagtgccaacaccggcggtattatgaaaatctag

DBGET integrated database retrieval system