KEGG   Bacillus subtilis subsp. subtilis 168: BSU21880Help
Entry
BSU21880          CDS       T00010                                 

Gene name
ypgR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virulence_fact HEAT_2 Nfu_N HEAT_PBS HEAT HEAT_EZ Cnd1 Adaptin_N DUF2336
Motif
Other DBs
NCBI-GeneID: 939082
NCBI-ProteinID: NP_390071
Pasteur: BG11613
BSORF: BG11613
UniProt: P54169
Position
complement(2302727..2303860)
Genome map
AA seq 377 aa AA seqDB search
MKIKSIEPTPSPNTMKVILTEELPAGKSNNYKPEQAEGAPLVIAEILKIDGVKGVYHVAD
FLAVERNARYDWKDILPQVRTAFGMESAESAEENRSDQESFGEVKVFVQMFSGIPMQVKL
TDGEREERFGLPERFQQAILKLRSEASNVVFERAWKEQGVRFGDFDEIGHDVTEELQAAY
SDERLKRLTEAAAQGKGEAKQAVQRKAYKVTLDMLDDEDWKKRYAHLEQMDPKEEDIPVL
QKALDDPKVSIRRQAVVYLGMIETPDVLPLLYKALEDKAVSVRRTAGDCLSDIGDPQAIP
AMIKSLSDSSKLVRWRAAMFLYEVGDESAIEALRAAEDDPEFEVSLQVKMALERIEHGEE
AKGSVWKQMTESRKKGE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaaatcaattgaacctacaccaagcccgaatacaatgaaagtcatcttaacg
gaagagcttccggcgggcaaaagcaataactataaacctgagcaagcagaaggcgcaccg
cttgttatagcggaaatccttaaaatagatggagttaaaggggtatatcacgtcgcagat
tttcttgctgttgaacggaatgcaagatacgactggaaagacattttaccgcaagtccgc
actgcatttgggatggaaagtgctgaaagcgcagaagaaaatcgttctgatcaagaatct
tttggagaggtaaaagtttttgtgcagatgttcagcggcattcctatgcaagttaaatta
accgatggagagcgggaagaacgcttcggcttacctgaacgctttcagcaggcgatctta
aaacttagatctgaagcttccaatgttgtgtttgagcgggcttggaaagaacaaggtgtc
agattcggtgactttgatgaaatcggccatgatgtgacagaagagcttcaagcggcatac
agtgatgaacggctgaaacgactgactgaagcagccgctcaaggaaagggcgaagcaaaa
caagctgtacagcgcaaagcgtataaagtaacgcttgatatgctggatgatgaggactgg
aaaaagcgttatgcacacttggaacagatggatccgaaagaagaggatatcccggtttta
cagaaggcattggatgatccaaaggtgtccatcagaagacaggctgttgtgtacttagga
atgattgaaacacctgatgttcttcctctattgtataaagcacttgaggacaaagctgta
tcagtcagaagaacggccggagactgcctgtctgatatcggcgatcctcaagccattcct
gctatgatcaagtcattaagcgactccagcaagcttgttcgctggcgtgccgccatgttc
ctgtacgaagtcggcgatgaaagtgcaattgaagctttgcgcgctgccgaagatgacccc
gaatttgaggtcagccttcaagtcaaaatggcgcttgaacgtattgagcatggagaagaa
gcaaaaggttctgtttggaaacaaatgacggaaagcagaaaaaaaggcgaataa

DBGET integrated database retrieval system