KEGG   Bacillus subtilis subsp. subtilis 168: BSU21890Help
Entry
BSU21890          CDS       T00010                                 

Gene name
ypgQ
Definition
(RefSeq) hypothetical protein
  KO
K06950  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU21890 (ypgQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD HD_3
Motif
Other DBs
NCBI-GeneID: 939080
NCBI-ProteinID: NP_390072
Pasteur: BG11612
BSORF: BG11612
UniProt: P54168
Position
complement(2303920..2304537)
Genome map
AA seq 205 aa AA seqDB search
MKELKQAEQIRTWVQSILTDESSGHDWHHVSRVADLAAYIGEKEKADLFIVETAALVHDL
IDVKLPDTVRLSVSEVYDQLVFFGVGKENADRVIHIITRMSFRDRGKLAKEPLSIEGKAV
QDADRLDAIGAVGIARAFMFAGAKGHGLYGDEQSAYAHFFHKLLRLKDMMNTDTARELAE
ERHNFMLQFVRQLEKDIPGIDAETS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggaattgaagcaggcagagcaaatcaggacatgggttcaatctatcctgactgac
gaaagctctggacatgactggcatcatgtatcaagagtagcagatcttgcagcgtatatt
ggagaaaaggaaaaagcggatttgttcattgttgaaacggcggctttggttcatgattta
attgatgtgaagctgcctgacacggtcaggctttctgtgagcgaagtatatgatcagctc
gtttttttcggagtaggaaaagagaatgctgacagggtgattcatattataacaaggatg
tcctttcgggacagggggaaattggcgaaggagccgctctcaattgaaggaaaagctgta
caggatgctgacagacttgatgcgattggtgctgtcggcattgcgagagctttcatgttt
gcgggcgcaaaagggcatggcctttatggagatgagcaaagcgcctacgctcattttttt
cataagctgctgcggctgaaagatatgatgaatacagacactgcacgggaactggcagaa
gaaagacacaattttatgcttcaatttgtccgccaattagaaaaagacatacccgggatt
gatgccgaaacgtcgtaa

DBGET integrated database retrieval system