KEGG   Bacillus subtilis subsp. subtilis 168: BSU21900Help
Entry
BSU21900          CDS       T00010                                 

Gene name
bsaA
Definition
(RefSeq) glutathione peroxidase BsaA
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00480  Glutathione metabolism
bsu00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BSU21900 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BSU21900 (bsaA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BSU21900 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 939086
NCBI-ProteinID: NP_390073
Pasteur: BG11530
BSORF: BG11530
UniProt: P52035
Position
complement(2304553..2305035)
Genome map
AA seq 160 aa AA seqDB search
MSIYHMKVRTITGKDMTLQPFAGKVLMIVNTASKCGFTSQLKQLQELYDTYQQEGLEILG
FPCNQFMNQEPGEEADIQEFCETNYGVTFPMFSKVDVNGKNAHPLFVYLTEHAKGMLGTK
AIKWNFTKFIVDRNGEIVGRYSPNTNPKELEDDIVKLLEQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttatcatatgaaggtacgtacaatcacagggaaagacatgacacttcagcct
ttcgcgggaaaggtactgatgatcgtgaatacagcaagtaagtgcggttttacttcccaa
ttgaagcagctgcaggaattatatgatacatatcagcaggaggggctggagatcttaggg
ttcccctgcaatcaattcatgaaccaagagcctggtgaagaggctgacatacaggaattt
tgtgaaacaaattacggtgttacatttcctatgttttcaaaagtggatgtaaacgggaaa
aacgcccacccgctgtttgtgtatttgacagaacatgcgaaagggatgctgggaactaag
gcgatcaagtggaatttcacgaaatttatagtggatagaaatggagaaatcgttggccgt
tattcaccaaatacaaatccgaaagagttggaagacgatatcgtgaagctattagagcaa
taa

DBGET integrated database retrieval system