KEGG   Bacillus subtilis subsp. subtilis 168: BSU21910Help
Entry
BSU21910          CDS       T00010                                 

Gene name
metA
Definition
(RefSeq) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU21910 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU21910 (metA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BSU21910 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     BSU21910 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS GATase
Motif
Other DBs
NCBI-GeneID: 939083
NCBI-ProteinID: NP_390074
Pasteur: BG11534
BSORF: BG11534
UniProt: P54167
Position
2305378..2306283
Genome map
AA seq 301 aa AA seqDB search
MPINIPTHLPAKQVLESEHIFVMDESRAFHQDIRPQKIIILNLMPKKIQTETQLLRLLGN
SPLQVHFTFLIPSTHTPKNTAREHLDEFYTTFSNIRHKRFDGMIITGAPIEHLAFEEVSY
WEELKEIMEWSKTNVTSTLHICWGAQAGLYYHYGVEKIQMPKKIFGVFEHTVLSKHERLV
RGFDELYYVPHSRHTDINMEQLQAVPELNILTASKEAGVCLIVSKDEKQVFLTGHPEYDT
NTLLQEYERDLERNLSTVEAPKHYFAKGSNEPVNRWKAHATLLFMNWLNYYVYQETPYEW
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgcctattaatataccaacacacctgccggcaaaacaggtgcttgaaagtgaacatata
tttgtaatggatgaaagcagagcatttcatcaggatatccggccgcaaaaaattattata
ttaaatttgatgccgaaaaaaatccaaacagagactcagcttctcagattgcttggaaat
tcgcctttacaggttcatttcacatttttaatcccaagcacacacacgccgaaaaatact
gcgagagaacaccttgacgaattttacacgactttttccaatatccgtcacaagaggttt
gacggcatgattatcaccggtgcgccgatcgagcatttggcgtttgaagaggtttcatat
tgggaagagctcaaggaaatcatggagtggagcaaaacaaatgtcacttcaaccttgcat
atttgctggggtgctcaagcaggtttgtattaccattacggtgtggaaaaaattcaaatg
ccgaaaaaaatcttcggtgtgttcgaacataccgttctttcaaaacacgaaagattggta
agaggttttgacgagctatactacgtgccgcattcccggcatacagatataaatatggaa
cagcttcaagcagtgcccgagttaaacattcttaccgcatcaaaggaagccggggtttgc
ttaattgtgtctaaagacgaaaaacaagtctttttgacagggcaccctgaatatgataca
aatacgcttcttcaagagtatgaaagagatttggaacgaaacctttctactgtcgaggcc
cctaaacattattttgcaaaaggcagcaacgagccagtgaatcgctggaaagcgcatgcc
acattattgtttatgaattggctgaattattacgtttaccaagaaactccttatgaatgg
gactaa

DBGET integrated database retrieval system