KEGG   Bacillus subtilis subsp. subtilis 168: BSU21920Help
Entry
BSU21920          CDS       T00010                                 

Gene name
ugtP
Definition
(RefSeq) processive diacylglycerol glucosyltransferase
  KO
K03429  processive 1,2-diacylglycerol beta-glucosyltransferase [EC:2.4.1.315]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00561  Glycerolipid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU21920 (ugtP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU21920 (ugtP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.315  diglucosyl diacylglycerol synthase (1,6-linking)
     BSU21920 (ugtP)
Glycosyltransferases [BR:bsu01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   BSU21920 (ugtP)
 Glycan extension
  Glycolipid
   BSU21920 (ugtP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MGDG_synth Glycos_transf_1 Glyco_tran_28_C Epimerase_2 Glyco_trans_1_4 Glyco_trans_1_2 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 939081
NCBI-ProteinID: NP_390075
Pasteur: BG11611
BSORF: BG11611
UniProt: P54166
Position
2306514..2307662
Genome map
AA seq 382 aa AA seqDB search
MNTNKRVLILTANYGNGHVQVAKTLYEQCVRLGFQHVTVSNLYQESNPIVSEVTQYLYLK
SFSIGKQFYRLFYYGVDKIYNKRKFNIYFKMGNKRLGELVDEHQPDIIINTFPMIVVPEY
RRRTGRVIPTFNVMTDFCLHKIWVHENVDKYYVATDYVKEKLLEIGTHPSNVKITGIPIR
PQFEESMPVGPIYKKYNLSPNKKVLLIMAGAHGVLKNVKELCENLVKDDQVQVVVVCGKN
TALKESLSALEAENGDKLKVLGYVERIDELFRITDCMITKPGGITLTEATAIGVPVILYK
PVPGQEKENANFFEDRGAAIVVNRHEEILESVTSLLADEDTLHRMKKNIKDLHLANSSEV
ILEDILKESEMMTAKQKAKVLS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgaataccaataaaagagtattaattttgactgcaaattacggaaatggacatgtgcag
gtagccaaaacactttatgaacaatgtgtacggctcggctttcagcatgtaacagtttct
aatttgtaccaagagtcaaatccgattgtttcagaggtaactcaatacctttatttaaaa
agcttctcaatcgggaaacagttttatcgtttgttttattacggagttgacaaaatctat
aataaacgtaaattcaatatttactttaaaatgggtaataaaagattgggcgaacttgtc
gatgaacatcagcccgatattattattaatacatttccgatgatcgtcgtgccggaatac
agacgccgaactggaagagtcattcctaccttcaacgttatgactgatttttgtcttcat
aaaatttgggttcacgaaaacgtggataaatattatgtggcgacagattacgtgaaggaa
aaactgctggagatcggcactcatccaagcaatgtaaaaatcacaggaattccaatcagg
ccgcaatttgaagaatccatgcctgttggcccgatatataaaaagtacaatctttcacca
aacaaaaaagtgcttctgatcatggcaggtgctcacggtgtattaaagaacgtaaaagag
ctgtgcgaaaaccttgtcaaggatgaccaagtgcaagtagttgtcgtgtgcgggaaaaat
acggctttaaaagaatctttgagtgcgcttgaagcggaaaatggtgacaaattaaaagtt
ctgggctatgtggagcgcattgatgagctatttcggatcacagattgcatgattaccaag
cccggcggcattactttgacagaagccacagccattggagtgcctgtcattctgtacaaa
cccgtgcctggccaggaaaaagaaaatgcaaacttctttgaagaccgcggagctgccatc
gttgtgaaccgtcatgaagagattctcgagtcagtcacttcccttcttgcagatgaagat
accttgcatcgcatgaagaaaaacattaaggaccttcatttagcaaactcctctgaagtg
attttagaggatatcctgaaggaatcagaaatgatgaccgccaaacaaaaagccaaagtg
ctatcgtaa

DBGET integrated database retrieval system