KEGG   Bacillus subtilis subsp. subtilis 168: BSU21930Help
Entry
BSU21930          CDS       T00010                                 

Gene name
cspD
Definition
(RefSeq) cold shock protein CspD
  KO
K03704  cold shock protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU21930 (cspD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB S1
Motif
Other DBs
NCBI-GeneID: 939079
NCBI-ProteinID: NP_390076
Pasteur: BG11531
BSORF: BG11531
UniProt: P51777
Position
2307905..2308105
Genome map
AA seq 66 aa AA seqDB search
MQNGKVKWFNNEKGFGFIEVEGGDDVFVHFTAIEGDGYKSLEEGQEVSFEIVEGNRGPQA
SNVVKL
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacggtaaagtaaaatggttcaacaacgaaaaaggattcggcttcattgaagtt
gaaggcggagacgatgtatttgttcacttcacagctatcgaaggagatggatacaaatca
ttagaagaaggacaagaagtttcttttgaaattgtcgaaggtaatcgtggacctcaagct
tctaatgttgtaaaactctaa

DBGET integrated database retrieval system