KEGG   Bacillus subtilis subsp. subtilis 168: BSU21930
Entry
BSU21930          CDS       T00010                                 

Gene name
cspD
Definition
(RefSeq) cold shock protein CspD
  KO
K03704  cold shock protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU21930 (cspD)
SSDB
Motif
Pfam: CSD OB_RNB
Other DBs
NCBI-GeneID: 939079
NCBI-ProteinID: NP_390076
Pasteur: BG11531
BSORF: BG11531
UniProt: P51777 A0A6M3ZDM5
Position
2307905..2308105
AA seq 66 aa
MQNGKVKWFNNEKGFGFIEVEGGDDVFVHFTAIEGDGYKSLEEGQEVSFEIVEGNRGPQA
SNVVKL
NT seq 201 nt   +upstreamnt  +downstreamnt
atgcaaaacggtaaagtaaaatggttcaacaacgaaaaaggattcggcttcattgaagtt
gaaggcggagacgatgtatttgttcacttcacagctatcgaaggagatggatacaaatca
ttagaagaaggacaagaagtttcttttgaaattgtcgaaggtaatcgtggacctcaagct
tctaatgttgtaaaactctaa

DBGET integrated database retrieval system