KEGG   Bacillus subtilis subsp. subtilis 168: BSU21940Help
Entry
BSU21940          CDS       T00010                                 

Gene name
degR
Definition
(RefSeq) regulatory protein DegR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939076
NCBI-ProteinID: NP_390077
Pasteur: BG10699
BSORF: BG10699
UniProt: P68731
Position
complement(2308157..2308339)
Genome map
AA seq 60 aa AA seqDB search
MDDKDLKLILHKTFIEIYSDLEELADIAKKGKPSMEKYVEEIEQRCKQNILAIEIQMKIK
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atggatgataaagacttgaagttgatccttcacaaaacatttatagaaatatacagtgat
ttagaagaactggccgatatcgcgaaaaaaggaaaaccatcaatggaaaagtatgttgaa
gagattgaacagaggtgtaaacaaaacattttggcgattgaaatccagatgaaaatcaaa
tag

DBGET integrated database retrieval system