KEGG   Bacillus subtilis subsp. subtilis 168: BSU21940
Entry
BSU21940          CDS       T00010                                 

Symbol
degR
Name
(RefSeq) regulatory protein DegR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939076
NCBI-ProteinID: NP_390077
Pasteur: BG10699
BSORF: BG10699
UniProt: P68731 A0A6M3ZD44
Position
complement(2308157..2308339)
AA seq 60 aa
MDDKDLKLILHKTFIEIYSDLEELADIAKKGKPSMEKYVEEIEQRCKQNILAIEIQMKIK
NT seq 183 nt   +upstreamnt  +downstreamnt
atggatgataaagacttgaagttgatccttcacaaaacatttatagaaatatacagtgat
ttagaagaactggccgatatcgcgaaaaaaggaaaaccatcaatggaaaagtatgttgaa
gagattgaacagaggtgtaaacaaaacattttggcgattgaaatccagatgaaaatcaaa
tag

DBGET integrated database retrieval system